PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00062886001 | ||||||||
Common Name | GSBRNA2T00062886001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 171aa MW: 18904.6 Da PI: 9.4082 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.5 | 7.1e-39 | 55 | 113 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk k GSBRNA2T00062886001 55 PDKIIACPRCKSMDTKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKTKP 113 68999***************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-28 | 54 | 112 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.2E-32 | 57 | 112 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.081 | 59 | 113 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 61 | 97 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MATQDLQGIK LFGKTIACNV NITDTHKIKN EDEKQPSDPT VRSSSLSDPT VEKRPDKIIA 60 CPRCKSMDTK FCYFNNYNAN QPRHFCKSCH RYWTAGGALR NVPVGAGRRK TKPLARVVVG 120 MLGDGNEAHH VELINGLLSH ELHSAAAARG GFRHDFPLKR LRCFSDGEPC * |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00062886001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013635531.1 | 1e-122 | PREDICTED: cyclic dof factor 4-like | ||||
Refseq | XP_013719282.1 | 1e-122 | cyclic dof factor 4-like | ||||
Refseq | XP_022556325.1 | 1e-122 | cyclic dof factor 4-like | ||||
Swissprot | O22967 | 1e-89 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A078JIK6 | 1e-125 | A0A078JIK6_BRANA; BnaC04g44370D protein | ||||
STRING | Bo4g182410.1 | 1e-122 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 6e-89 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|