PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00060389001

Common Name

GSBRNA2T00060389001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB

Protein Properties

Length: 132aa MW: 15717.2 Da PI: 11.1671

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00060389001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.9	5.6e-14	11	46	12	48
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 l ++v+++G+++Wk+Ia+++g +R +kqc++rw+++l GSBRNA2T00060389001 11 LRKLVELYGTKNWKRIANMLG-TRIGKQCRERWHNHL 46 899****************.***********97 PP
2	Myb_DNA-binding	56.5	6.5e-18	52	94	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + +WT+eEd++lv+a+k +G++ W++Ia ++ gRt++ +k+rw+ GSBRNA2T00060389001 52 KSAWTEEEDQILVEAHKVFGNK-WAKIALRLC-GRTENAIKNRWN 94 679*****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.169	1	46	IPR017930	Myb domain
SMART	SM00717	9.2E-4	9	48	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.3E-19	10	52	IPR009057	Homeodomain-like
Pfam	PF00249	3.5E-13	11	46	IPR001005	SANT/Myb domain
CDD	cd00167	1.42E-9	11	46	No hit	No description
SuperFamily	SSF46689	4.97E-27	26	105	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.497	47	101	IPR017930	Myb domain
SMART	SM00717	1.9E-16	51	99	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-16	52	94	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.9E-21	53	99	IPR009057	Homeodomain-like
CDD	cd00167	7.31E-11	54	94	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MSSFETHNIN LRKLVELYGT KNWKRIANML GTRIGKQCRE RWHNHLRHGI KKSAWTEEED 60 QILVEAHKVF GNKWAKIALR LCGRTENAIK NRWNGTKRRM HQKRMKQSDK NANPPQKCHL 120 RKIYKTCQKQ E*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-34	13	99	20	106	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in embryos from the early heart stage and throughout embryogenesis (PubMed:18695688, PubMed:19066902). Induced at the onset of the maturation phase in the endosperm, in a high and homogeneous repartition (PubMed:18695688, PubMed:19066902, PubMed:25194028, PubMed:27681170). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:19066902, ECO:0000269\|PubMed:25194028, ECO:0000269\|PubMed:27681170}.
Uniprot	DEVELOPMENTAL STAGE: Induced at the onset of the maturation phase in the endosperm at low levels in a heterogeneous repartition, particularly in the chalazal endosperm. Also detected in pollen grains. {ECO:0000269\|PubMed:27681170}.
Uniprot	TISSUE SPECIFICITY: Accumulates in reproductive organs (e.g. flowers and siliques) (PubMed:18695688, PubMed:27681170). Expressed at very low levels in vegetative organs (PubMed:27681170). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:27681170}.
Uniprot	TISSUE SPECIFICITY: Mainly expressed in siliques (PubMed:18695688, PubMed:19066902). Also detected at low levels in leaves and flowers (PubMed:19066902). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:19066902}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:19066902, ECO:0000269\|PubMed:25194028, ECO:0000269\|PubMed:27681170}.
UniProt	Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of target genes (PubMed:27681170). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner (PubMed:18695688). Together with MYB118, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:27681170}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00060389001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by LEC2 but repressed by MYB118. {ECO:0000269\|PubMed:27681170}.
UniProt	INDUCTION: Induced by LEC2. {ECO:0000269\|PubMed:25194028}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013745691.2	1e-71	transcription factor MYB115-like
Swissprot	Q1PDP9	2e-39	MY115_ARATH; Transcription factor MYB115
Swissprot	Q9LVW4	6e-39	MY118_ARATH; Transcription factor MYB118
TrEMBL	A0A078HDA5	6e-92	A0A078HDA5_BRANA; BnaC04g32680D protein
STRING	Bra025564.1-P	1e-71	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13303	14	27

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G40360.1	7e-42	myb domain protein 115

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Troncoso-Ponce MA, et al. Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds. Plant Cell, 2016. 28(10): p. 2666-2682 [PMID:27681170] Ettaki H, et al. Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents. PLoS ONE, 2018. 13(1): p. e0192156 [PMID:29381741]