PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00059244001 | ||||||||
Common Name | GSBRNA2T00059244001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 86aa MW: 9687.75 Da PI: 7.4401 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37.1 | 7.2e-12 | 31 | 62 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd+ll ++v+ G g W+++a++ g GSBRNA2T00059244001 31 KGPWTPEEDKLLTEYVTSKGEGKWSSVAKCAG 62 79****************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.464 | 26 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.6E-9 | 29 | 66 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.2E-12 | 30 | 63 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.9E-9 | 31 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.24E-6 | 33 | 63 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MLDWGVDQVH QPNHDHDPYQ KQQKQLQGCR KGPWTPEEDK LLTEYVTSKG EGKWSSVAKC 60 AGTINKDKLG DRGDDRLSSC RNFTV* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00059244001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013619948.1 | 9e-39 | PREDICTED: myb-related protein 340-like | ||||
TrEMBL | A0A078HEB1 | 4e-57 | A0A078HEB1_BRANA; BnaC02g38100D protein | ||||
STRING | Bo2g149430.1 | 3e-39 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM31175 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30210.1 | 7e-23 | myb domain protein 121 |
Publications ? help Back to Top | |||
---|---|---|---|
|