PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00057787001 | ||||||||
Common Name | GSBRNA2T00057787001, GSBRNA2T00087190001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 153aa MW: 16763.3 Da PI: 10.7128 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 74.5 | 1.6e-23 | 91 | 145 | 1 | 55 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsf 55 s+yk+kaa++v++++p+f++ldsg++kl+++G+lll++a+a+++r+ydW+kkq++ GSBRNA2T00057787001 91 SIYKGKAAVTVEPRAPEFVSLDSGAFKLSKDGSLLLQFAPAAGVRQYDWSKKQVW 145 7****************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 4.5E-25 | 82 | 145 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 8.63E-23 | 85 | 146 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 9.2E-20 | 92 | 144 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MSQLLSSPLV ALSYNPFASP RFLSSSSSVL VATGGLAVKR HVLASKPTKT VKLTVKSRQT 60 DYFEKQRFGD SSERVLSKCE GGPARFYVGH SIYKGKAAVT VEPRAPEFVS LDSGAFKLSK 120 DGSLLLQFAP AAGVRQYDWS KKQVWFHPFN FR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4koo_A | 3e-36 | 79 | 145 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_B | 3e-36 | 79 | 145 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_C | 3e-36 | 79 | 145 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
4koo_D | 3e-36 | 79 | 145 | 2 | 68 | Single-stranded DNA-binding protein WHY1, chloroplastic |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00057787001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009110543.1 | 4e-75 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9M9S3 | 1e-65 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | A0A078JNN5 | 1e-106 | A0A078JNN5_BRANA; BnaAnng23380D protein | ||||
STRING | Bra016702.1-P | 1e-74 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5023 | 27 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 4e-62 | ssDNA-binding transcriptional regulator |