PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00047454001 | ||||||||
Common Name | GSBRNA2T00047454001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 200aa MW: 22917.4 Da PI: 8.8705 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 68.4 | 6.9e-22 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krie+ks rqvtf+kRrng++ KA LSvLC+ va++++sstgkly+ GSBRNA2T00047454001 9 KRIESKSSRQVTFCKRRNGLIEKARQLSVLCESSVAILMVSSTGKLYT 56 79*********************************************9 PP | |||||||
2 | K-box | 32 | 5e-12 | 110 | 164 | 44 | 98 |
K-box 44 esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ s++ L++Le+q + +l+ R++K++l++e +++l +kek l+een+ L ++l GSBRNA2T00047454001 110 DDASVESLNSLEEQFKAALSVTRARKTQLMMEFLKNLEEKEKLLREENQILASQL 164 5668999********************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.7E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-25 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.871 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-20 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-21 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.745 | 70 | 170 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 7.9E-10 | 109 | 164 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MGRRKVEIKR IESKSSRQVT FCKRRNGLIE KARQLSVLCE SSVAILMVSS TGKLYTSSYG 60 DSMEKIIKRY EIQHADELKN LDLEEKFRKY LSYKELVDIV QCKCEEAKVD DASVESLNSL 120 EEQFKAALSV TRARKTQLMM EFLKNLEEKE KLLREENQIL ASQLTKMEKK RLPETEGEGA 180 MSSENSSRNS PPETLPLLK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 8e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 8e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 8e-15 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, leaves and flowers, and, to a lower extent, in inflorescence, siliques, pollen and shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00047454001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC166741 | 2e-98 | AC166741.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH080C09, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009130488.1 | 1e-141 | PREDICTED: protein MADS AFFECTING FLOWERING 5-like | ||||
Swissprot | Q9LSR7 | 9e-87 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A078H1H3 | 1e-140 | A0A078H1H3_BRANA; BnaA02g34520D protein | ||||
TrEMBL | A0A3G5BC80 | 1e-140 | A0A3G5BC80_BRARC; Maf-like protein | ||||
STRING | XP_006394081.1 | 1e-103 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65050.3 | 8e-72 | AGAMOUS-like 31 |
Publications ? help Back to Top | |||
---|---|---|---|
|