PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00035274001
Common NameGSBRNA2T00035274001, LOC106424649
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 334aa    MW: 37532.9 Da    PI: 6.969
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00035274001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.5e-061052440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                         ++C+++ +   + +C+ ++ +lC +C  + H        H++v
  GSBRNA2T00035274001 10 QTCDTCRSAACTVYCRADSAYLCTNCDAQVHAAnrlasrHERV 52
                         79******99*********************556788888776 PP

2zf-B_box35.71.7e-115297342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  GSBRNA2T00035274001 52 VRVCQSCERAPAAFFCKADAASLCTACDSQIHSAnplarrHQRVPI 97
                         689*****************************66899999**9997 PP

3CCT65.31.7e-22263307145
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                          R+a+++RY+eK+ktRkFeK+irY+sRK++Ae+RpR+KGrF+k++e
  GSBRNA2T00035274001 263 RKARVMRYREKKKTRKFEKRIRYASRKEYAEKRPRIKGRFAKRNE 307
                          9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.4E-9754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.836754IPR000315B-box-type zinc finger
CDDcd000219.27E-81254No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006434.0E-95297IPR000315B-box-type zinc finger
CDDcd000211.63E-95397No hitNo description
SMARTSM003361.9E-125597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.807263305IPR010402CCT domain
PfamPF062039.7E-17263305IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MLKQESNWAQ TCDTCRSAAC TVYCRADSAY LCTNCDAQVH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS QIHSANPLAR RHQRVPILPI SGSMVTNHSS ETTETEDIVV  120
VGQEEEDEAE AASWLLHSSV KNSGDNNNNN NNSENRFSVG DEYVDLVDYN KYQQDYNVPQ  180
RSYVADGVVP LQVGVLKSHM HHEEHNFQFG FTNVSSEASP IHMVSLVPES TLSETTVSHP  240
RSPKVATEEL HDAPVQMLSP VERKARVMRY REKKKTRKFE KRIRYASRKE YAEKRPRIKG  300
RFAKRNEVDA EEADKAFSSM VMFDTGYGIV PSF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves and at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00035274001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2957780.0AM295778.1 Brassica oleracea var. alboglabra 1col1-O9 gene for CONSTANS-like1 protein and 1co-O9 gene for CONSTANS protein, exons 1-2, clone JBo061D17.
GenBankAM2957790.0AM295779.1 Brassica oleracea var. alboglabra 1col1-O2 gene for CONSTANS-like1 protein, clone JBo052K23.
GenBankAM2957810.0AM295781.1 Brassica oleracea var. alboglabra 1col1-O3 gene for CONSTANS-like1 protein, clone JBo045L20.
GenBankAM2957830.0AM295783.1 Brassica oleracea var. italica 1col1-GD gene for CONSTANS-like1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013720864.10.0zinc finger protein CONSTANS-LIKE 1
SwissprotO500551e-149COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A078GIZ60.0A0A078GIZ6_BRANA; BnaC09g41980D protein
STRINGBo9g163720.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-124CONSTANS-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  3. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  4. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]