PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034307001
Common NameGSBRNA2T00034307001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 131aa    MW: 15210.7 Da    PI: 10.8255
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034307001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538.1e-171057148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
  GSBRNA2T00034307001 10 KGAWTAEEDSLLRRCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                         79*********************************************7 PP

2Myb_DNA-binding49.97.4e-1663108148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg+ + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
  GSBRNA2T00034307001  63 RGKLSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDIKNYWNTHL 108
                          78999*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.464557IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-22560IPR009057Homeodomain-like
SuperFamilySSF466898.03E-298104IPR009057Homeodomain-like
SMARTSM007172.7E-14959IPR001005SANT/Myb domain
PfamPF002497.4E-161057IPR001005SANT/Myb domain
CDDcd001674.42E-101257No hitNo description
PROSITE profilePS5129424.82358112IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2361111IPR009057Homeodomain-like
SMARTSM007171.9E-1462110IPR001005SANT/Myb domain
PfamPF002492.1E-1463108IPR001005SANT/Myb domain
CDDcd001671.93E-683108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MEDSSKGLTK GAWTAEEDSL LRRCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPT  60
IKRGKLSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDI KNYWNTHLSK KHEPCCKTKM  120
KKRNVTFSST T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-2381112104MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-2381112104C-Myb DNA-Binding Domain
1msf_C6e-2381112104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in mature plant aerial part. Detected ubiquitously, with higher levels in rosette leaves and flowers. {ECO:0000269|PubMed:17147621, ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of. phenylpropanoid-derived compounds such as anthocyanins and proanthocyanidin, probably together with GL3 and BHLH2. Regulates the expression of CHS, DFRA, LDOX, and BAN. {ECO:0000269|PubMed:11148285, ECO:0000269|PubMed:12917293, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15807784, ECO:0000269|PubMed:16299184, ECO:0000269|PubMed:17147621}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00034307001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By jasmonic acid (JA), NaCl, sucrose, UV light, nitrogen deficiency and drought. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0136971e-150KM013697.1 Raphanus sativus MYB transcription factor gene, complete cds; plastid.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627019.19e-91PREDICTED: transcription factor MYB114 isoform X1
RefseqXP_013708778.29e-91transcription factor MYB114 isoform X1
SwissprotQ9FE256e-75MYB75_ARATH; Transcription factor MYB75
TrEMBLA0A078K1L91e-90A0A078K1L9_BRANA; BnaAnng41910D protein (Fragment)
TrEMBLA0A2P1E4T92e-89A0A2P1E4T9_BRAOV; Anthocyanin
TrEMBLA0A398A8W42e-89A0A398A8W4_BRACM; Uncharacterized protein
TrEMBLA0A3N6PXE52e-89A0A3N6PXE5_BRACR; Uncharacterized protein
TrEMBLE5D8F32e-89E5D8F3_BRAOB; MYB1
STRINGBra001917.1-P2e-89(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.13e-77production of anthocyanin pigment 1
Publications ? help Back to Top
  1. Zhang Y, et al.
    Pathway engineering for phenolic acid accumulations in Salvia miltiorrhiza by combinational genetic manipulation.
    Metab. Eng., 2014. 21: p. 71-80
    [PMID:24269612]
  2. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  3. Liu W, et al.
    Synthetic TAL effectors for targeted enhancement of transgene expression in plants.
    Plant Biotechnol. J., 2014. 12(4): p. 436-46
    [PMID:24373379]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  6. Ilk N,Ding J,Ihnatowicz A,Koornneef M,Reymond M
    Natural variation for anthocyanin accumulation under high-light and low-temperature stress is attributable to the ENHANCER OF AG-4 2 (HUA2) locus in combination with PRODUCTION OF ANTHOCYANIN PIGMENT1 (PAP1) and PAP2.
    New Phytol., 2015. 206(1): p. 422-35
    [PMID:25425527]
  7. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  8. Shin DH, et al.
    Identification of genes that may regulate the expression of the transcription factor production of anthocyanin pigment 1 (PAP1)/MYB75 involved in Arabidopsis anthocyanin biosynthesis.
    Plant Cell Rep., 2015. 34(5): p. 805-15
    [PMID:25604992]
  9. Tian J, et al.
    McMYB10 regulates coloration via activating McF3'H and later structural genes in ever-red leaf crabapple.
    Plant Biotechnol. J., 2015. 13(7): p. 948-61
    [PMID:25641214]
  10. Wang L,ZengJ HQ,Song J,Feng SJ,Yang ZM
    miRNA778 and SUVH6 are involved in phosphate homeostasis in Arabidopsis.
    Plant Sci., 2015. 238: p. 273-85
    [PMID:26259194]
  11. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  12. Boter M, et al.
    FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate.
    Plant Cell, 2015. 27(11): p. 3160-74
    [PMID:26530088]
  13. He X,Li Y,Lawson D,Xie DY
    Metabolic engineering of anthocyanins in dark tobacco varieties.
    Physiol Plant, 2017. 159(1): p. 2-12
    [PMID:27229540]
  14. Broeckling BE,Watson RA,Steinwand B,Bush DR
    Intronic Sequence Regulates Sugar-Dependent Expression of Arabidopsis thaliana Production of Anthocyanin Pigment-1/MYB75.
    PLoS ONE, 2016. 11(6): p. e0156673
    [PMID:27248141]
  15. Li Y, et al.
    Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis.
    Sci Rep, 2016. 6: p. 30514
    [PMID:27465838]
  16. Lee WJ, et al.
    Drastic anthocyanin increase in response to PAP1 overexpression in fls1 knockout mutant confers enhanced osmotic stress tolerance in Arabidopsis thaliana.
    Plant Cell Rep., 2016. 35(11): p. 2369-2379
    [PMID:27562381]
  17. Khare D, et al.
    Root avoidance of toxic metals requires the GeBP-LIKE 4 transcription factor in Arabidopsis thaliana.
    New Phytol., 2017. 213(3): p. 1257-1273
    [PMID:27768815]
  18. Li S, et al.
    MYB75 Phosphorylation by MPK4 Is Required for Light-Induced Anthocyanin Accumulation in Arabidopsis.
    Plant Cell, 2016. 28(11): p. 2866-2883
    [PMID:27811015]
  19. Sawano H, et al.
    Double-stranded RNA-binding protein DRB3 negatively regulates anthocyanin biosynthesis by modulating PAP1 expression in Arabidopsis thaliana.
    J. Plant Res., 2017. 130(1): p. 45-55
    [PMID:27995376]
  20. Zou B, et al.
    Calmodulin-binding protein CBP60g functions as a negative regulator in Arabidopsis anthocyanin accumulation.
    PLoS ONE, 2017. 12(3): p. e0173129
    [PMID:28253311]
  21. Zhang Y, et al.
    GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation.
    Plant Cell Rep., 2017. 36(4): p. 557-569
    [PMID:28275852]
  22. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  23. Xu Z,Mahmood K,Rothstein SJ
    ROS Induces Anthocyanin Production Via Late Biosynthetic Genes and Anthocyanin Deficiency Confers the Hypersensitivity to ROS-Generating Stresses in Arabidopsis.
    Plant Cell Physiol., 2017. 58(8): p. 1364-1377
    [PMID:28586465]
  24. Park JJ,Dempewolf E,Zhang W,Wang ZY
    RNA-guided transcriptional activation via CRISPR/dCas9 mimics overexpression phenotypes in Arabidopsis.
    PLoS ONE, 2017. 12(6): p. e0179410
    [PMID:28622347]
  25. Lowder LG,Paul JW,Qi Y
    Multiplexed Transcriptional Activation or Repression in Plants Using CRISPR-dCas9-Based Systems.
    Methods Mol. Biol., 2017. 1629: p. 167-184
    [PMID:28623586]
  26. Kataya ARA, et al.
    PLATINUM SENSITIVE 2 LIKE impacts growth, root morphology, seed set, and stress responses.
    PLoS ONE, 2017. 12(7): p. e0180478
    [PMID:28678890]
  27. Duan S, et al.
    Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana.
    Plant Sci., 2018. 268: p. 47-53
    [PMID:29362083]