PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00025985001 | ||||||||
Common Name | GSBRNA2T00025985001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 187aa MW: 20667.9 Da PI: 7.6202 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.3 | 7.1e-56 | 20 | 116 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 vreqdrflPian+srimk+ lPan+ki+kdake++qecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y+eplk+yl++y GSBRNA2T00025985001 20 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEILQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKLYLTRY 109 69**************************************************************************************** PP NF-YB 91 relegek 97 re+ g++ GSBRNA2T00025985001 110 REVYGDS 116 ***9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.5E-53 | 16 | 145 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.29E-40 | 23 | 137 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.5E-27 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-21 | 54 | 72 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-21 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 1.9E-21 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MAESQTNSPG DQSPRSSSHV REQDRFLPIA NISRIMKRGL PANGKIAKDA KEILQECVSE 60 FISFVTSEAS DKCQREKRKT INGDDLLWAM ATLGFEEYIE PLKLYLTRYR EVYGDSKGSA 120 RGGDANANRD GQSSQNGQFS QFAHQGSYPQ GPYGNSQVTF PLLLFHTHSE YVSATHITTQ 180 IISSAK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-46 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-46 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00025985001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009141626.1 | 1e-106 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q8VYK4 | 4e-93 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A078K009 | 1e-137 | A0A078K009_BRANA; BnaCnng76740D protein | ||||
STRING | Bra017209.1-P | 1e-127 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 4e-85 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|