PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00025661001 | ||||||||
Common Name | GSBRNA2T00025661001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 203aa MW: 23158.9 Da PI: 9.3553 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.3 | 1.3e-16 | 44 | 91 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +l+d+vk++G g+W+t+ ++ + R++k+c++rw ++l GSBRNA2T00025661001 44 KGPWTSTEDGILIDYVKRHGEGNWNTVQKHTSLARCGKSCRLRWANHL 91 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.8e-16 | 97 | 140 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g++++eE++l+v+ ++++G++ W+ a++++ gRt++++k++w++ GSBRNA2T00025661001 97 KGAFSKEEEQLIVEMHARMGNK-WAQMAEHLP-GRTDNEIKNYWNT 140 799*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.927 | 39 | 91 | IPR017930 | Myb domain |
SMART | SM00717 | 7.6E-11 | 43 | 93 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.91E-29 | 43 | 138 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.1E-23 | 45 | 98 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.34E-9 | 46 | 91 | No hit | No description |
Pfam | PF13921 | 1.6E-15 | 47 | 107 | No hit | No description |
PROSITE profile | PS51294 | 25.079 | 92 | 146 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-16 | 96 | 144 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 99 | 145 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.11E-12 | 99 | 140 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MSYTMVTDES DDAMYSSIYN ESPSAADNIG SGCTSRGKGS VLKKGPWTST EDGILIDYVK 60 RHGEGNWNTV QKHTSLARCG KSCRLRWANH LRPNLKKGAF SKEEEQLIVE MHARMGNKWA 120 QMAEHLPGRT DNEIKNYWNT RIKRRQRAGL PLYPPGTHVE DLHWSQQYHP STSNVTDRRR 180 HQDILQLGNS KANVLFDDLT FAN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-33 | 42 | 145 | 5 | 107 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In germinating seeds, present in the root tip and in a linear array of up to 20 to 30 cells above the root tip. Strongly expressed in the inflorescence apex, and, to some extent, in the inflorescence stem, the vascular tissue, and the vascular tissue in leaf primordia (PubMed:11743113). In flowers, expressed in sepals, style, receptacle, anther filaments, and connective but not in anthers themselves (PubMed:15722475). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15722475}. | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots (e.g. root tips), stems, pollen, shoot apices, flowers and floral shoot tips, and, to a lower extent, in leaves and siliques. {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:24278028}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of alpha-amylase expression that binds to 5'-CAACTGTC-3' motif in target gene promoter (PubMed:11743113). In vegetative tissues, inhibits growth by reducing cell proliferation. Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB101, promotes the programmed cell death (PCD) the vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Together with MYB33, facilitates anther and tapetum development (PubMed:15722475). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:20699403}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00025661001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by microRNA159 (miR159a and miR159b) in vegetative tissues (PubMed:20699403, PubMed:17916625, PubMed:15226253). Specific expression in floral organs and in the shoot apices is regulated via miR159-mediated degradation (PubMed:15722475). Slightly induced by ethylene and salicylic acid (PubMed:16463103). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17916625, ECO:0000269|PubMed:20699403}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009121136.1 | 1e-151 | PREDICTED: transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_009121138.1 | 1e-151 | PREDICTED: transcription factor GAMYB-like isoform X2 | ||||
Refseq | XP_018511248.1 | 1e-151 | PREDICTED: transcription factor GAMYB-like isoform X1 | ||||
Swissprot | Q9FR97 | 1e-119 | MYB65_ARATH; Transcription factor MYB65 | ||||
TrEMBL | A0A078JX28 | 1e-153 | A0A078JX28_BRANA; BnaAnng40310D protein (Fragment) | ||||
STRING | Bra002042.1-P | 1e-150 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G11440.1 | 1e-121 | myb domain protein 65 |