PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024517001
Common NameGSBRNA2T00024517001, LOC106385344
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 86aa    MW: 10474.9 Da    PI: 10.2756
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024517001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.2e-073674444
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                         +T++E++l+ +  ++ G++ W++Ia ++  gR + ++  +w
  GSBRNA2T00024517001 36 MTEQEEDLISRMYRLVGNR-WDLIAGRVA-GRRASEIERYW 74
                         7******************.*********.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.4E-53280IPR001005SANT/Myb domain
CDDcd001671.40E-43574No hitNo description
PfamPF002491.1E-63675IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-93675IPR009057Homeodomain-like
SuperFamilySSF466891.64E-63775IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MDDTNRLRRL RSHKHTKFIR HNSEEVTSIK WEFINMTEQE EDLISRMYRL VGNRWDLIAG  60
RVAGRRASEI ERYWIMKNND YFSKQ*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in inflorescences and trichomes of rosette and cauline leaves. {ECO:0000269|PubMed:20622149}.
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269|PubMed:17933793}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024517001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2344111e-48AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBankAY5195201e-48AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBankAY6492551e-48AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626295.15e-57PREDICTED: MYB-like transcription factor TCL1
RefseqXP_013680730.15e-57MYB-like transcription factor TCL1
SwissprotD3GKW68e-41TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBLA0A078GC021e-55A0A078GC02_BRANA; BnaC03g16910D protein
TrEMBLA0A0D3B4821e-55A0A0D3B482_BRAOL; Uncharacterized protein
TrEMBLA0A3P6A8801e-55A0A3P6A880_BRAOL; Uncharacterized protein
STRINGBo3g024610.12e-56(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30432.13e-43MYB_related family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Features of Arabidopsis genes and genome discovered using full-length cDNAs.
    Plant Mol. Biol., 2006. 60(1): p. 69-85
    [PMID:16463100]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Zheng K, et al.
    Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation.
    Sci Rep, 2016. 6: p. 19254
    [PMID:26758286]
  5. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  6. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]