PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00007082001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 179aa MW: 20891.6 Da PI: 9.2523 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.8 | 2.1e-53 | 17 | 146 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatg 87 +ppGfrFhPt+eel+ +yLkkkv+ ++++l +vi+evd++k+ePw+L++ ++ + ++ewyfFs++dkky+tg+r+nrat++g+Wkatg GSBRNA2T00007082001 17 VPPGFRFHPTEEELLYYYLKKKVSYEPIDL-DVIREVDLNKLEPWELKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATG 105 69****************************.9***************952444443456******************************* PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +dk+++ ++++++gl+ktLvfy+grap+g+kt+W+mheyrl GSBRNA2T00007082001 106 RDKSIHLNSSKKIGLRKTLVFYTGRAPHGHKTEWIMHEYRL 146 ***************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-59 | 9 | 166 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.514 | 17 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.2E-28 | 18 | 146 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MEIGSSSTVA GGGQLSVPPG FRFHPTEEEL LYYYLKKKVS YEPIDLDVIR EVDLNKLEPW 60 ELKEKCRIGS GPQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKSI HLNSSKKIGL 120 RKTLVFYTGR APHGHKTEWI MHEYRLDDTE NEIQEDGWVV CRVFKKKNHF RGFHQEPDQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-51 | 14 | 168 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-51 | 14 | 168 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-51 | 14 | 168 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-51 | 14 | 168 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swm_B | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swm_C | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swm_D | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swp_A | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swp_B | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swp_C | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
3swp_D | 4e-51 | 14 | 168 | 17 | 170 | NAC domain-containing protein 19 |
4dul_A | 4e-51 | 14 | 168 | 14 | 167 | NAC domain-containing protein 19 |
4dul_B | 4e-51 | 14 | 168 | 14 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed at early heart stage onward in all root basal daughter cells resulting from horizontal divisions in the COL progenitors and is later maintained in these cells. Present in root stem cell daughters and accumulates in maturing root cap layers. Detectable from very early stages of lateral root development. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. | |||||
Uniprot | TISSUE SPECIFICITY: Accumulates in maturing root cap cells, in both COL and LRC cells. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00007082001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC010793 | 1e-114 | AC010793.3 Genomic sequence for Arabidopsis thaliana BAC F20B17 from chromosome I, complete sequence. | |||
GenBank | CP002684 | 1e-114 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590910.1 | 1e-133 | PREDICTED: protein SOMBRERO | ||||
Swissprot | Q9MA17 | 1e-125 | SMB_ARATH; Protein SOMBRERO | ||||
TrEMBL | A0A0D3CVS7 | 1e-132 | A0A0D3CVS7_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6FWE5 | 1e-132 | A0A3P6FWE5_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g080930.1 | 1e-133 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6653 | 25 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79580.3 | 1e-106 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|