PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g23656.1.p
Common NameBRADI_5g23656, LOC104581443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 273aa    MW: 30167.8 Da    PI: 8.7787
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g23656.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18197231135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       Cs+C++t+Tp+WR+gp g +tLCnaCGl+y+  ++
  Bradi5g23656.1.p 197 CSHCKSTDTPQWREGPLGRRTLCNACGLRYKMGRE 231
                       *******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.101.1E-15191229IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.23E-14191239No hitNo description
SMARTSM004011.0E-17191243IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.349191228IPR000679Zinc finger, GATA-type
CDDcd002026.82E-14196254No hitNo description
PROSITE patternPS003440197222IPR000679Zinc finger, GATA-type
PfamPF003201.5E-16197231IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MRRPNNNVFL SLHDVDDVAS LHCDRSSSCR HGESALCCPD DSLDEVLNCI PPLEDELLEA  60
LGIDCSSPVL HGNPNNSAVD ARTVVDVPPK SEHSLSVQEQ LVSPFHHWTI PKKPRGRAGT  120
VRKRPWPHPV IVGATGYQFR HGSNGGPRQP TEPRPVIAAA TGANQFAQGS NGGRRQPVNP  180
RRGRRPGNED ENEPRACSHC KSTDTPQWRE GPLGRRTLCN ACGLRYKMGR EKLVPEYCPS  240
TSPFFRDGKH SNRHSKVEKL RKKEERASME SS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g23656.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227308.10.0GATA transcription factor 12
TrEMBLA0A0Q3EAU10.0A0A0Q3EAU1_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-24GATA transcription factor 4