PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17057.1.p
Common NameBRADI_5g17057, LOC100836839
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 438aa    MW: 46667.2 Da    PI: 7.1038
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17057.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA603e-19355389135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Bradi5g17057.1.p 355 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 389
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.61E-14347409No hitNo description
SMARTSM004013.7E-18349403IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.136349385IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-15353387IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.73E-15354411No hitNo description
PROSITE patternPS003440355380IPR000679Zinc finger, GATA-type
PfamPF003203.1E-17355389IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MLHQTLIPSS SPSCPSVSAS LSSPLLYPSN AKDTAAATTT ASSSPLLCSP AMPSYAHHRS  60
SLDERMEALK GSSRQEETAE EVAAAAEAPA AWGFGDRDGF SVEDLLDLEE FCEADKDGAD  120
EHEAAPAAAD NQEKSNDDSL QSVVSYDVVV PHAPSVPEIV DLPAHDAEEL EWVSRIMDDS  180
LSELPPPPPP PTATMMASLA GRAPQHRLMM LQQRRPHDGA YRALPSSASD PLRTPTICAL  240
STEALVPIKA KRSKRSRASG WSLSGAAPDS TSSSSTTTTS SCSSSASFSP YFLMDSAHLG  300
ASDLTEDYTL GGPPPKKYKH GKHSKHKPKK RGRKPKHLPP HPASAAVSFP SDRRCSHCGV  360
QKTPQWRAGP EGAKTLCNAC GVRYKSGRLL PEYRPACSPT FESTIHSNSH RKVLEMRRKK  420
EDGPLTVSAT APAVASF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g17057.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581466.10.0GATA transcription factor 5
TrEMBLI1J0550.0I1J055_BRADI; Uncharacterized protein
STRINGBRADI5G17057.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-40GATA transcription factor 5