PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bradi5g15587.1.p

Common Name

BRADI_5g15587, LOC100840483

Organism

Brachypodium distachyon

Taxonomic ID

15368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium

Family

NAC

Protein Properties

Length: 289aa MW: 32197 Da PI: 5.4139

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bradi5g15587.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	166.1	1.3e-51	10	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF P+d+elv++yL kkv++++ + ++ evd++ ePw+Lp +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev Bradi5g15587.1.p 10 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVR 101 79***********************888.78***********77777889********************************* PP NAM 94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++++vg++ktLvfy+grap+g+kt+Wvmhe+rl Bradi5g15587.1.p 102 NPsTRAVVGMRKTLVFYQGRAPNGTKTSWVMHEFRL 137 9867778*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-59	8	156	IPR003441	NAC domain
PROSITE profile	PS51005	58.18	10	156	IPR003441	NAC domain
Pfam	PF02365	4.0E-28	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 289 aa Download sequence Send to blast
MGLREIESTL PPGFRFYPSD QELVCHYLYK KVTNERASQG TLVEVDLHAR EPWELPDVAK 60 LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RNPSTRAVVG MRKTLVFYQG 120 RAPNGTKTSW VMHEFRLDTP HLPPREDWVL CRVFEKQKGD GEQDNISASS PAFAGSSQAA 180 AAQEPHQPML DTSNDQIMGS AMGFVPRQDQ EEVCGSNYPL LNAAMWQQYS SVLDTFPLQE 240 EIMVGSSPMM GLGAARSGAG DDCGFLFDSG FDDVANFGAG MRFPQGWS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-50	1	157	4	166	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-50	1	157	4	166	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-50	1	157	4	166	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-50	1	157	4	166	NO APICAL MERISTEM PROTEIN
3swm_A	4e-50	1	157	7	169	NAC domain-containing protein 19
3swm_B	4e-50	1	157	7	169	NAC domain-containing protein 19
3swm_C	4e-50	1	157	7	169	NAC domain-containing protein 19
3swm_D	4e-50	1	157	7	169	NAC domain-containing protein 19
3swp_A	4e-50	1	157	7	169	NAC domain-containing protein 19
3swp_B	4e-50	1	157	7	169	NAC domain-containing protein 19
3swp_C	4e-50	1	157	7	169	NAC domain-containing protein 19
3swp_D	4e-50	1	157	7	169	NAC domain-containing protein 19
4dul_A	4e-50	1	157	4	166	NAC domain-containing protein 19
4dul_B	4e-50	1	157	4	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:12787253, ECO:0000269\|PubMed:14617069, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bradi5g15587.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17056621, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK248480	0.0	AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003580130.1	0.0	protein CUP-SHAPED COTYLEDON 1
Swissprot	Q9FRV4	8e-62	NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBL	I1IZM6	0.0	I1IZM6_BRADI; Uncharacterized protein
STRING	BRADI5G15587.1	0.0	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP697	38	166
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	4e-81	NAC domain containing protein 74

Link Out ? help Back to Top
Phytozome	Bradi5g15587.1.p
Entrez Gene	100840483

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Shinohara N,Ohbayashi I,Sugiyama M Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration. Front Plant Sci, 2014. 5: p. 159 [PMID:24808900] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292]