PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi4g37327.1.p | ||||||||
Common Name | BRADI_4g37327, LOC100828630 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 218aa MW: 25221.3 Da PI: 6.7588 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.3 | 3.6e-54 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L k + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++ Bradi4g37327.1.p 6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRS 97 79****************************.99**************84335556888*********************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++ +g+kktLvfy+grap+g +++Wvmheyr+ Bradi4g37327.1.p 98 INY-QKRSIGMKKTLVFYQGRAPQGIRSNWVMHEYRI 133 **9.9999***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.31E-63 | 4 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.495 | 6 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-30 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSFLPSR 60 DPEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRSINY QKRSIGMKKT LVFYQGRAPQ 120 GIRSNWVMHE YRIEESECNN TMGIQDSYAL CRVFKKNVPV GEFEKQGECS TSRAKDNQEE 180 VTDFEDAGQS SGAAENDKDN SWMQFIVDDL WCTNKTK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-55 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-55 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-55 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-55 | 1 | 157 | 12 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_B | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_C | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swm_D | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_A | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_B | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_C | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
3swp_D | 2e-55 | 1 | 157 | 15 | 169 | NAC domain-containing protein 19 |
4dul_A | 2e-55 | 1 | 157 | 12 | 166 | NAC domain-containing protein 19 |
4dul_B | 2e-55 | 1 | 157 | 12 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi4g37327.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012617 | 3e-79 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010238477.1 | 1e-164 | NAC domain-containing protein 86 | ||||
Swissprot | Q9FFI5 | 6e-85 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | I1ISL6 | 1e-163 | I1ISL6_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G37327.1 | 1e-164 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 1e-111 | NAC domain containing protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi4g37327.1.p |
Entrez Gene | 100828630 |
Publications ? help Back to Top | |||
---|---|---|---|
|