PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g37327.1.p
Common NameBRADI_4g37327, LOC100828630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 218aa    MW: 25221.3 Da    PI: 6.7588
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g37327.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.6e-5461331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++
  Bradi4g37327.1.p   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRS 97 
                       79****************************.99**************84335556888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +++ +g+kktLvfy+grap+g +++Wvmheyr+
  Bradi4g37327.1.p  98 INY-QKRSIGMKKTLVFYQGRAPQGIRSNWVMHEYRI 133
                       **9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-634157IPR003441NAC domain
PROSITE profilePS5100559.4956156IPR003441NAC domain
PfamPF023653.0E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRSINY QKRSIGMKKT LVFYQGRAPQ  120
GIRSNWVMHE YRIEESECNN TMGIQDSYAL CRVFKKNVPV GEFEKQGECS TSRAKDNQEE  180
VTDFEDAGQS SGAAENDKDN SWMQFIVDDL WCTNKTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55115712166NO APICAL MERISTEM PROTEIN
1ut4_B2e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_A2e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_B2e-55115712166NO APICAL MERISTEM PROTEIN
3swm_A2e-55115715169NAC domain-containing protein 19
3swm_B2e-55115715169NAC domain-containing protein 19
3swm_C2e-55115715169NAC domain-containing protein 19
3swm_D2e-55115715169NAC domain-containing protein 19
3swp_A2e-55115715169NAC domain-containing protein 19
3swp_B2e-55115715169NAC domain-containing protein 19
3swp_C2e-55115715169NAC domain-containing protein 19
3swp_D2e-55115715169NAC domain-containing protein 19
4dul_A2e-55115712166NAC domain-containing protein 19
4dul_B2e-55115712166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g37327.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126173e-79CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238477.11e-164NAC domain-containing protein 86
SwissprotQ9FFI56e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLI1ISL61e-163I1ISL6_BRADI; Uncharacterized protein
STRINGBRADI4G37327.11e-164(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-111NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]