PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi4g36460.2.p | ||||||||
Common Name | BRADI_4g36460, LOC100833219 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 240aa MW: 27044.1 Da PI: 8.7659 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++k +G g+W++ ++ g+ R++k+c++rw +yl Bradi4g36460.2.p 14 KGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 58.8 | 1.2e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++++eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ Bradi4g36460.2.p 67 RGNFSEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.407 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.47E-29 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.00E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.969 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-28 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.46E-13 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010224 | Biological Process | response to UV-B | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0090379 | Biological Process | secondary cell wall biogenesis involved in seed trichome differentiation | ||||
GO:1903086 | Biological Process | negative regulation of sinapate ester biosynthetic process | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDDRLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF SEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLSRG 120 IDPVSHRPTN EHVSNVTISF EAAREEKGSM FRLDEPKPAI GHDPVDWGQG KPLKCPDLNL 180 DLCISPPFQE DPMKPVKREA GVGVCFSCSL GLPRSSECKC SNFLGLRTAM LDFRSLEMK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-28 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00479 | DAP | Transfer from AT4G38620 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi4g36460.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679410 | 1e-160 | HF679410.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB4 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003578527.1 | 1e-177 | myb-related protein Hv1 | ||||
Swissprot | P20026 | 1e-138 | MYB1_HORVU; Myb-related protein Hv1 | ||||
TrEMBL | I1ISA0 | 1e-176 | I1ISA0_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G36460.1 | 1e-177 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 1e-101 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi4g36460.2.p |
Entrez Gene | 100833219 |