PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi4g34680.1.p | ||||||||
Common Name | BRADI_4g34680 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 248aa MW: 28368.2 Da PI: 8.7982 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.8 | 1.1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Bradi4g34680.1.p 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 100.2 | 2.9e-33 | 85 | 176 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +e++ +s+++e+ kLk+++enLqr+qR+llGedL+sL +keL++Le+qL++sl++iRs++++++l+q+ +lq+ke++l e+n++Lr+klee Bradi4g34680.1.p 85 KENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGSLGIKELEELEKQLDSSLRHIRSTRTQHMLDQLTDLQRKEQMLCEANRCLRRKLEE 176 46667899*********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.137 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.14E-45 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 7.19E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.0E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.0E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.0E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.5E-26 | 87 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.338 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG 60 QSMPKTLERY QKCSYSGPDT AVQNKENELV QSSRNEYLKL KARVENLQRT QRNLLGEDLG 120 SLGIKELEEL EKQLDSSLRH IRSTRTQHML DQLTDLQRKE QMLCEANRCL RRKLEESSQV 180 HGHMWEHAAN LLGYDQRQSP QQQAPHHGGN GFFHPLDAAS EPTLQIGFTP EQMSSSCVTA 240 FLPTWLP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 7e-32 | 75 | 174 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_B | 7e-32 | 75 | 174 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_C | 7e-32 | 75 | 174 | 1 | 101 | Developmental protein SEPALLATA 3 |
4ox0_D | 7e-32 | 75 | 174 | 1 | 101 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi4g34680.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ588325 | 0.0 | HQ588325.1 Brachypodium distachyon MADS-box (SEP3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001289804.1 | 0.0 | MADS-box transcription factor 8 | ||||
Swissprot | Q9SAR1 | 1e-164 | MADS8_ORYSJ; MADS-box transcription factor 8 | ||||
TrEMBL | I1IRL7 | 0.0 | I1IRL7_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G34680.1 | 0.0 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3483 | 34 | 69 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.1 | 9e-94 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi4g34680.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|