PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g30177.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 406aa    MW: 45483.2 Da    PI: 6.1881
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g30177.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52141411128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       l pGfrFhPtdeelv +yLk+k+++k+l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++
  Bradi4g30177.1.p  14 LLPGFRFHPTDEELVGFYLKRKIQQKPLSI-ELIRQLDIYKYDPWDLPKLASSGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIY 105
                       579***************************.89***************8888999************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  Bradi4g30177.1.p 106 SSeGTKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 141
                       *956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5810172IPR003441NAC domain
PROSITE profilePS5100557.04614172IPR003441NAC domain
PfamPF023651.2E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MDERCDMDKS EEVLLPGFRF HPTDEELVGF YLKRKIQQKP LSIELIRQLD IYKYDPWDLP  60
KLASSGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYKGRAAKGI KTDWMMHEFR LPSLTDPSLP KIPIDKNIPA NDAWAICRIF KKPSSMAQRA  180
LSHSWGPQST AMTEPDLLSA LQSIQASHFA LEGSSRSAEL ALPANRFNSQ QSFQGRQLQK  240
LNSSENGSSC KVINFNLSPS LTHLSDKDIH SGPIIMPFET QTLQKSSDAT SVVLSIAPGI  300
INSIHEASPN TELEQPEECN GYAVDWVMDT DKGIGNSDED PYTRKAENGY ITGNQCGVSR  360
KIKFPFDLGE DSSDDWACSI RCESLTCPEP PPEMSNSCST EKYYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-531417517168NO APICAL MERISTEM PROTEIN
1ut4_B5e-531417517168NO APICAL MERISTEM PROTEIN
1ut7_A5e-531417517168NO APICAL MERISTEM PROTEIN
1ut7_B5e-531417517168NO APICAL MERISTEM PROTEIN
4dul_A5e-531417517168NAC domain-containing protein 19
4dul_B5e-531417517168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g30177.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757877.20.0LOW QUALITY PROTEIN: protein FEZ
SwissprotQ9ZVH05e-99FEZ_ARATH; Protein FEZ
TrEMBLI1IQ380.0I1IQ38_BRADI; Uncharacterized protein
STRINGBRADI4G30177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]