PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g23550.1.p
Common NameBRADI_4g23550, LOC104585044
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 358aa    MW: 39023.9 Da    PI: 7.6299
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g23550.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA43.93.3e-14261294134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C++C + +Tp+WR+gp+gn tLCnaCG++y+  +
  Bradi4g23550.1.p 261 CTHCCSWQTPQWRHGPNGNGTLCNACGIRYKMGK 294
                       *******************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.9E-12255309IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.018259292IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.6E-11259294IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.42E-12259317No hitNo description
CDDcd002028.51E-16260316No hitNo description
PfamPF003204.5E-12261294IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRKPGQYVYL HEDPLALDVV DGLDLSPPGG GLCSPDDPLD KVMTYVALLD DGFLEDLGID  60
CSTLLDEESS RSALEEGGGG ALPVAAAAAS PGGTKRSARE VFDGVPGAPS SIPVSTTSAG  120
PFLGTLEAPD FGEDLSWTVL PKPHHRRTAA RRRQVWPVSF PLALTTSPGP AAAAHDDSNA  180
NDDVKDKDFK LISRCNVGKC NGNKRRRLSE PKKRQRDKDN VEDKDFELVG YCNDVGVGNG  240
KQRRSAEPKQ QLDKDGRLRT CTHCCSWQTP QWRHGPNGNG TLCNACGIRY KMGKLCEEYR  300
PSTSPEFSSL KHSNRHRNVE KIRDQKMKQL KVTSPVPVVP VTPDSSEVLL RMCKYET*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203207KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g23550.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239253.10.0uncharacterized protein LOC104585044
TrEMBLI1IMV80.0I1IMV8_BRADI; Uncharacterized protein
STRINGBRADI4G23550.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.13e-25GATA transcription factor 4