PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi4g11630.1.p | ||||||||
Common Name | BRADI_4g11630 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 95aa MW: 11436.8 Da PI: 4.4979 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 44 | 7.4e-14 | 25 | 78 | 1 | 54 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrt 54 +fYn+YA e GFsvr+s+ + + n+e + r+fvCs+eg+re++ k+++++ r+ Bradi4g11630.1.p 25 EFYNSYALEKGFSVRISYVEWDEANEEKILRKFVCSREGSREKHMKREDRKWRK 78 6*****************************************999883333333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 1.6E-11 | 25 | 80 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MVDESIDEYL DIVERTFGNE DDGFEFYNSY ALEKGFSVRI SYVEWDEANE EKILRKFVCS 60 REGSREKHMK REDRKWRKMN YAAYMTRVEV DEIL* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi4g11630.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014751141.1 | 2e-41 | protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | I1IJT9 | 2e-61 | I1IJT9_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G11630.1 | 4e-62 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2449 | 9 | 76 | Representative plant | OGRP11434 | 2 | 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi4g11630.1.p |