PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi4g02570.4.p | ||||||||
Common Name | BRADI_4g02570, LOC100834249 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 188aa MW: 20426.9 Da PI: 8.4726 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.4 | 2.1e-15 | 111 | 164 | 4 | 57 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 kr +r+ +NRe+ArrsR+RK+a + e v +L aeN +L k+l ++++++ Bradi4g02570.4.p 111 AKRVKRMLSNRESARRSRKRKQAHQTDIESQVTQLRAENASLLKRLTDMTQKYK 164 79*************************************999966555555554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.5E-12 | 107 | 164 | No hit | No description |
SMART | SM00338 | 1.3E-15 | 108 | 172 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.1E-14 | 110 | 164 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.07 | 110 | 165 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.99E-12 | 112 | 163 | No hit | No description |
CDD | cd14702 | 6.69E-16 | 113 | 163 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 115 | 130 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071215 | Biological Process | cellular response to abscisic acid stimulus | ||||
GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042802 | Molecular Function | identical protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MEFGADEVVE VNCARGGSGG GDPGVYAAVL KRKLDLYCAA VAKTMEAKPQ ESALGAMQLV 60 SQASDTSQLV SQASFDGDGT VVQGKPANSC TSREQSDVDG DLEENTDPAN AKRVKRMLSN 120 RESARRSRKR KQAHQTDIES QVTQLRAENA SLLKRLTDMT QKYKEATLGN RNLTVDMETM 180 RRKVWAL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 124 | 130 | RRSRKRK |
2 | 124 | 131 | RRSRKRKQ |
3 | 126 | 131 | SRKRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00040 | PBM | Transfer from AT5G28770 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi4g02570.4.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK251589 | 1e-176 | AK251589.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf118p04, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003577778.1 | 1e-132 | light-inducible protein CPRF2 | ||||
Swissprot | Q99090 | 1e-30 | CPRF2_PETCR; Light-inducible protein CPRF2 | ||||
TrEMBL | A0A2K2CK50 | 1e-135 | A0A2K2CK50_BRADI; Uncharacterized protein | ||||
STRING | BRADI4G02570.1 | 1e-132 | (Brachypodium distachyon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28770.3 | 5e-26 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi4g02570.4.p |
Entrez Gene | 100834249 |
Publications ? help Back to Top | |||
---|---|---|---|
|