PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g54720.1.p
Common NameBRADI_3g54720, LOC100841640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 417aa    MW: 43800.2 Da    PI: 5.6758
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g54720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.2e-18336369134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  Bradi3g54720.1.p 336 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 369
                       *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.6E-16330380IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.09E-14330392No hitNo description
PROSITE profilePS5011411.213330366IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14334367IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.45E-14335392No hitNo description
PfamPF003201.2E-15336369IPR000679Zinc finger, GATA-type
PROSITE patternPS003440336361IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MASGRFMEEM MREHEQVLLE ATLYDHIDDL LDFPKEEDCA ADVLLLDAPA PGSPLSARII  60
GAPPVPPPPS MELAAPPPPA AAAVPAFFAA EAFGSKDCHI GPCEELDMDM AQLEWLSGLF  120
DDASIPHEPA FNCAAPIKAS AMGATNAAAA VVIPDKLEDA LFRSSSPTSV LEDNSFNNVG  180
AGAKNNNNVN NGSGGSSASS SSSSSASSCS ESFSGSGGAR TTWSAPVSPR PEPPVLIIPA  240
RARSKRSRQS AFVRSSAPAA EPTILVPTPM YSSTSAHSDP ESCNIAETNS QPPAMKKKKK  300
AKKPAPPVTS DAEGDADADY EEGGGSALPP GAVRRCTHCQ IEKTPQWRAG PLGPKTLCNA  360
CGVRYKSGRL FPEYRPAASP TFVPAIHSNS HKKVVEMRQK VAPKGDDLLQ YIRRRD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g54720.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3536491e-118AK353649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1001M24.
GenBankAK3566851e-118AK356685.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1038B06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235943.10.0GATA transcription factor 10
RefseqXP_010235944.10.0GATA transcription factor 10
RefseqXP_024316778.10.0GATA transcription factor 10
TrEMBLI1IDP30.0I1IDP3_BRADI; Uncharacterized protein
STRINGBRADI3G54720.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-37GATA family protein