PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g49620.1.p
Common NameBRADI_2g49620, LOC100846806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 400aa    MW: 41878.7 Da    PI: 6.2695
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g49620.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.5e-18271305135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +C t kTp+WR gp g+ktLCnaCG+++++ +l
  Bradi2g49620.1.p 271 CLHCETDKTPQWRTGPMGPKTLCNACGVRFKSGRL 305
                       99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.4E-691360IPR016679Transcription factor, GATA, plant
SMARTSM004012.4E-18265315IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14265302IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.479265301IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.9E-15267328No hitNo description
CDDcd002022.67E-14270317No hitNo description
PROSITE patternPS003440271296IPR000679Zinc finger, GATA-type
PfamPF003201.5E-15271305IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MEATAPPEYD GYYGRDKKAV VACAGDHFVV DDLLALPACD DDDEEGDGGE AFLAVDTQQL  60
PPAKEEGGGG FGNASGDSST VTALESCTNS FSGLADGDFS GGLCEPYDQL ADLEWLSNYM  120
GEGEEAFASE DLQKLQLISG IPSGGFSSAG ARPPAPAAQA AAAAQQPTMF LPEAPVPVPA  180
KARSKRSRAA AGNWSSRLLV LPPAPASPPS PASMAISPAE SGVSGAAQAF HVKKPSSKPA  240
KKKDAPQALA PTSAPGTPTG VSAAASEGRR CLHCETDKTP QWRTGPMGPK TLCNACGVRF  300
KSGRLVPEYR PAASPTFVTS KHSNSHRKVL ELRRQRDMHH HHHGGQQQQQ QPPQHVVTGS  360
LMHMQSPLLF DGPSAPPIVA AGDDFLLHHR SATDYRQFM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g49620.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567108.10.0GATA transcription factor 12
TrEMBLI1HRH30.0I1HRH3_BRADI; GATA transcription factor
STRINGBRADI2G49620.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.12e-47GATA transcription factor 9