PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g35057.1.p | ||||||||
Common Name | BRADI_2g35057, LOC100845583 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 155aa MW: 17076 Da PI: 9.0959 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 62.5 | 5.2e-20 | 24 | 58 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt+Tp+WR+gp g+++LCnaCG++yrkk++ Bradi2g35057.1.p 24 CVECRTTTTPMWRSGPTGPRSLCNACGIRYRKKRR 58 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.2E-16 | 18 | 76 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.09E-13 | 20 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.8E-15 | 22 | 59 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 7.9E-18 | 24 | 58 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.545 | 24 | 54 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 24 | 49 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.42E-12 | 24 | 59 | No hit | No description |
SuperFamily | SSF81995 | 6.28E-5 | 63 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MDSPHHKAIG VAAAAAAEGG RMCCVECRTT TTPMWRSGPT GPRSLCNACG IRYRKKRRQE 60 LGLDNKQLQS QPQQQQEQQQ HQQQEQQQQQ QEQQQHQQQE DHSEPTSAVK DSSSSPSKTS 120 KLQVVKKRRV SMGVEEAASL LMALSSSSTP TLHG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g35057.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003566530.1 | 1e-108 | GATA transcription factor 17 | ||||
TrEMBL | I1HLM1 | 1e-107 | I1HLM1_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G35057.1 | 1e-107 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 7e-19 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g35057.1.p |
Entrez Gene | 100845583 |