PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g32792.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 84aa MW: 9233.34 Da PI: 8.3624 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 41.8 | 1.5e-13 | 2 | 36 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C t kT +WR g + ++ LCnaCG++ k+g+ Bradi2g32792.1.p 2 CQHCFTRKTRQWRLGTREKSPLCNACGIRLIKNGE 36 ****************98888********988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 5.23E-12 | 1 | 58 | No hit | No description |
PROSITE profile | PS50114 | 9.605 | 1 | 39 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 2 | 27 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 7.5E-11 | 2 | 39 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 2.7E-11 | 2 | 36 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 1.93E-11 | 2 | 39 | No hit | No description |
SMART | SM00401 | 4.1E-5 | 2 | 47 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MCQHCFTRKT RQWRLGTREK SPLCNACGIR LIKNGELHPE YHLAASETFV GAIHSNIHRR 60 VLELHSENQG TDGSSSSTGE TAA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g32792.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003562098.1 | 1e-18 | GATA transcription factor 4 | ||||
Swissprot | Q9SV30 | 6e-18 | GATA8_ARATH; GATA transcription factor 8 | ||||
TrEMBL | A0A2K2DBH4 | 4e-55 | A0A2K2DBH4_BRADI; Uncharacterized protein | ||||
STRING | BRADI1G75420.1 | 5e-18 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1417 | 33 | 108 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G25830.1 | 3e-20 | GATA transcription factor 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g32792.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|