PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g32792.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 84aa    MW: 9233.34 Da    PI: 8.3624
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g32792.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA41.81.5e-13236135
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C++C t kT +WR g + ++ LCnaCG++  k+g+
  Bradi2g32792.1.p  2 CQHCFTRKTRQWRLGTREKSPLCNACGIRLIKNGE 36
                      ****************98888********988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.23E-12158No hitNo description
PROSITE profilePS501149.605139IPR000679Zinc finger, GATA-type
PROSITE patternPS003440227IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.5E-11239IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.7E-11236IPR000679Zinc finger, GATA-type
CDDcd002021.93E-11239No hitNo description
SMARTSM004014.1E-5247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MCQHCFTRKT RQWRLGTREK SPLCNACGIR LIKNGELHPE YHLAASETFV GAIHSNIHRR  60
VLELHSENQG TDGSSSSTGE TAA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g32792.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562098.11e-18GATA transcription factor 4
SwissprotQ9SV306e-18GATA8_ARATH; GATA transcription factor 8
TrEMBLA0A2K2DBH44e-55A0A2K2DBH4_BRADI; Uncharacterized protein
STRINGBRADI1G75420.15e-18(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-20GATA transcription factor 12
Publications ? help Back to Top
  1. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  2. Li T,Wu XY,Li H,Song JH,Liu JY
    A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network.
    Mol Plant, 2016. 9(5): p. 650-661
    [PMID:26961720]