PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23978.1.p
Common NameBRADI_2g23978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB_related
Protein Properties Length: 220aa    MW: 23815.6 Da    PI: 6.3688
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23978.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-14154198347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Bradi2g23978.1.p 154 PWSEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 198
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.2434298IPR017930Myb domain
SMARTSM007170.444496IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-64791IPR009057Homeodomain-like
SuperFamilySSF466891.01E-1047100IPR009057Homeodomain-like
CDDcd001670.003884785No hitNo description
PROSITE profilePS5129418.366147203IPR017930Myb domain
SuperFamilySSF466891.36E-17149202IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-16151201IPR006447Myb domain, plants
SMARTSM007173.4E-10151201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-11153197IPR009057Homeodomain-like
CDDcd001672.81E-10154199No hitNo description
PfamPF002493.8E-11154198IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAFYGGMGMG MGAGQGASSS SQAPGQQQQP MTMMPAAPPM PMPSVRPWTR AEDKVFESAL  60
VAFPEHVQNR WAYVASQLPG RTAQEAWEHY QALIEDVDLI EAGFIETPES WDEEEEAAAA  120
AAAATTAAAA AAASAAAGGG ARRGRGEERR RGVPWSEEEH RLFLEGLEKY GRGDWRNISR  180
WSVKTRTPTQ VASHAQKYFL RLAGKGDTKR KSIHDITNP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g23978.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679546e-56AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566206.31e-159transcription factor DIVARICATA
TrEMBLA0A2K2DA651e-157A0A2K2DA65_BRADI; Uncharacterized protein
STRINGBRADI2G23980.11e-109(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-40MYB family protein