PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi2g05740.1.p | ||||||||
Common Name | BRADI_2g05740, LOC100835199 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 240aa MW: 25894.1 Da PI: 8.213 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.8 | 1.9e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l d+++++G+g +W t +++ g++R++k+c++rw++yl Bradi2g05740.1.p 14 RGPWSPEEDDKLRDYIQRHGTGgSWITFPKKAGLRRCGKSCRLRWLNYL 62 89*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 42.8 | 1.2e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T eEd l+ + +lG++ W++Ia+ + +Rt++++k++w++ Bradi2g05740.1.p 69 GGFTDEEDALIFSLYSKLGSK-WSLIASQLE-RRTDNDVKNHWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.128 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.18E-27 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-9 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.7E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-23 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.99E-8 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 22.726 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-12 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-22 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.46E-10 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGRAPCCDRA AVKRGPWSPE EDDKLRDYIQ RHGTGGSWIT FPKKAGLRRC GKSCRLRWLN 60 YLRPDIRHGG FTDEEDALIF SLYSKLGSKW SLIASQLERR TDNDVKNHWN TKLKKRLAAF 120 SSPPSSSSSF LPAPAPMAVA VAHPLALAVP TVKAETYAYD DFMAPPAALH VFDHPFGNGA 180 DQPGSTTSAS AASSMSNWSS AADNAGAADG FFADFCNAGA ADQFLGGFYY PLDPTLSLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-24 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of genes involved in the regulation of meristematic competence, such as CUC2. Positively regulates axillary meristems (AMs) formation and development, especially at early phases of vegetative growth, probably by specifying a stem cell niche for AM formation. Modulates the negative regulation mediated by gibberellic acid on the timing of developmental phase transitions. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:16473968}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi2g05740.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By a shift from short days to long days, in the axils of primordia on the elongating stem. {ECO:0000269|PubMed:16461581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951908 | 1e-148 | JF951908.1 Triticum aestivum clone TaMYB25 R2R3-MYB protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003564735.1 | 1e-177 | transcription factor RAX1 | ||||
Swissprot | Q9FG68 | 4e-68 | RAX1_ARATH; Transcription factor RAX1 | ||||
TrEMBL | I1HCW4 | 1e-176 | I1HCW4_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G05740.1 | 1e-176 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G36890.1 | 1e-65 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi2g05740.1.p |
Entrez Gene | 100835199 |
Publications ? help Back to Top | |||
---|---|---|---|
|