PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g76340.1.p
Common NameBRADI_1g76340, LOC100826804
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 922aa    MW: 102826 Da    PI: 5.3188
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g76340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.84.4e-28602652252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Bradi1g76340.1.p 602 EKTVSLQELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 652
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.87591672IPR003035RWP-RK domain
PfamPF020429.8E-26604652IPR003035RWP-RK domain
SuperFamilySSF542777.29E-23816908No hitNo description
Gene3DG3DSA:3.10.20.2402.6E-23822905No hitNo description
SMARTSM006661.8E-25824906IPR000270PB1 domain
PROSITE profilePS5174522.763824906IPR000270PB1 domain
PfamPF005641.7E-18825905IPR000270PB1 domain
CDDcd064074.06E-37825905No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 922 aa     Download sequence    Send to blast
MEQQQQQPQS HEDGLRGCGM MMGMRSDVAG REELDLMEEF LLASPGLDFS EFLHPGDGEF  60
DIGSSITTAA TPPPPPPPAL AGDDDDDEAD AERPGRAWLL QAEADTVKER LRRALQGIAS  120
RSQSAAGELL VQVWVPTRIG DRQVLTTCGQ PFWFDSRSDR LESYRTVSVK YQFSADESAC  180
AELGLPGRVF VGRVPEWTPD VRYFTDQEYP RVRHAQHFDI RGSVAMPVFD RRRSSSSSRG  240
CLGVVELVMT TQKINYNAEI ENICNALGEV DLRSSDVSSD PRAQVFESSY RAVVPEILHV  300
LRAVCDTHKL PLAQTWIPCV CQAKRASRHS DEKYKYCVST VDEACYVRDT DVIGFHQACS  360
EHHLFRGEGV VGTALRTNEP CFSPDITTYS KVQYPLSHYA KLFSLRAAVA IRLRSVRTGS  420
LDFVLEFFLP RNCIKSEDQG LMLSSLSNTI QQVCCTLRVV SVKELVDDES PETNLPTPPE  480
FYARATEKFD EICSGINVPA RTTSLEASEE VSSWIASLVD VQNKGAKEEI DCDLPFGFSK  540
QEDEGFSVTA GWRTSPVLVP EDGFLSEFKQ HEEYEAKEVI CSSDPSLSNS DKAVEKRRTK  600
MEKTVSLQEL RKHFAGSLKE AAKNLGVCPT TLKRICRQHG INRWPSRKIK KVGHSLKKLQ  660
MVIDSVHGAE GTVRLSSLYE NFTKTTWSER ELQGDLSCPA SEQKVHLEPS VPDRLCEGRF  720
SSHTSGSNSL SPTYSQSSNS SLGCSSDPKP QQQHGSAPQP AIKQEVSMEE NQSSILMKAA  780
SHAELQIFTE ERPVTLCRSQ SHMFFSEHKP VENMSTMQEH KPDPLKIKAM YGEERCIFRL  840
QPSWGFEKLR EEITKRFGIS QETCDLKYLD DESEWVLLTC DADLLECVDV YKSASAKTVR  900
ISVNPTGQPV LDGSFGHTAL S*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g76340.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229248.10.0protein NLP1
RefseqXP_010229249.10.0protein NLP1
RefseqXP_014752173.10.0protein NLP1
RefseqXP_014752174.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLI1HA460.0I1HA46_BRADI; Uncharacterized protein
STRINGBRADI1G76340.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]