PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g75420.1.p
Common NameBRADI_1g75420, LOC100842928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 222aa    MW: 23641.6 Da    PI: 9.0263
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g75420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.5e-18119153135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++C + +Tp+WR gpdg++tLCnaCG++++  +l
  Bradi1g75420.1.p 119 CTHCASEETPQWRLGPDGPRTLCNACGVRFKTGRL 153
                       *******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.0E-16113163IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.78113149IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-14116177No hitNo description
Gene3DG3DSA:3.30.50.101.0E-13117151IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.59E-14118167No hitNo description
PfamPF003201.6E-16119153IPR000679Zinc finger, GATA-type
PROSITE patternPS003440119144IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAGGGHVDKD AAALAAQDLP GLNVFFDQTG LETAAGGEGA GDEEEELEWL SNKDAFPSVE  60
TMAVEAPPEL EALAATRPAV VGPRTKGVRR RRRVTAPWNV LTPAVLPPPA RAAGPRRKCT  120
HCASEETPQW RLGPDGPRTL CNACGVRFKT GRLVPEYRPA KSPTFSPLLH SNSHRRVLEM  180
RRRNQDDDGE TPRATAAARR AERAASRLSA KAAADAPAQT A*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g75420.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562098.11e-158GATA transcription factor 4
TrEMBLI1H9U01e-156I1H9U0_BRADI; Uncharacterized protein
STRINGBRADI1G75420.11e-157(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-35GATA transcription factor 1