PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi1g45165.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 128aa MW: 14741.1 Da PI: 8.5008 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 85.6 | 4.5e-27 | 40 | 90 | 2 | 52 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 ek ++++ +s+yF+lpi +AA+eL+v+lT+LK++CR +GI+RWPhRk++sl Bradi1g45165.1.p 40 EKVLTFKLVSRYFHLPIVQAARELNVGLTILKKKCRDLGIPRWPHRKMNSL 90 7889*********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 18.371 | 26 | 110 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 3.4E-21 | 43 | 90 | IPR003035 | RWP-RK domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016554 | Biological Process | cytidine to uridine editing |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MEQSESKREE SEKGLPIICC SDEIGAAFHT KRGDRVRPEE KVLTFKLVSR YFHLPIVQAA 60 RELNVGLTIL KKKCRDLGIP RWPHRKMNSL QNLINNVEVL KEAGKTNDDE QLKAMVEMLE 120 QERRLLE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi1g45165.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014751743.1 | 1e-89 | protein RKD1 | ||||
Swissprot | Q9M9U9 | 2e-25 | RKD1_ARATH; Protein RKD1 | ||||
TrEMBL | A0A2K2DPF1 | 3e-88 | A0A2K2DPF1_BRADI; Uncharacterized protein | ||||
STRING | BRADI1G45170.1 | 1e-81 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4590 | 33 | 65 | Representative plant | OGRP567 | 17 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18790.1 | 6e-28 | RWP-RK domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi1g45165.1.p |