PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bradi1g08340.1.p | ||||||||
Common Name | BRADI_1g08340, LOC100842079 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27900.7 Da PI: 9.5665 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.4 | 3e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklye+++ Bradi1g08340.1.p 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEFAT 59 79***********************************************86 PP | |||||||
2 | K-box | 108.8 | 5.9e-36 | 78 | 173 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 + +s+e++ + ++++e++kLk+++e++q+ q+hl+GedLesL+lkeLqqLeqqLe+slk+iRs+Kn+l++e+i+elq+ke++lqeenkaL+k Bradi1g08340.1.p 78 KVLVSTESEIQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLESSLKHIRSRKNQLMHESISELQRKERSLQEENKALQK 170 556667788889********************************************************************************9 PP K-box 97 kle 99 +l Bradi1g08340.1.p 171 ELV 173 986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.291 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.5E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.27E-34 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.62E-42 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.7E-31 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 18.141 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEFATD 60 SCMDKILERY ERYSYAEKVL VSTESEIQGN WCHEYRKLKA KVETIQKCQK HLMGEDLESL 120 NLKELQQLEQ QLESSLKHIR SRKNQLMHES ISELQRKERS LQEENKALQK ELVEKQKAHT 180 QQAQWEQTHP QTSSSSSSMQ REAPPTTNIS NRPAAAGERT EEAAGQAQAR VGLPPWMVSH 240 ISG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bradi1g08340.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF469327 | 0.0 | KF469327.1 Brachypodium distachyon MADS-box transcription factor 33 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001288319.1 | 1e-180 | MADS-box transcription factor 14-like | ||||
Swissprot | Q10CQ1 | 1e-134 | MAD14_ORYSJ; MADS-box transcription factor 14 | ||||
TrEMBL | I1GN76 | 1e-178 | I1GN76_BRADI; MADS-box transcription factor 33 | ||||
STRING | BRADI1G08340.1 | 1e-179 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-78 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bradi1g08340.1.p |
Entrez Gene | 100842079 |