PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00080.66
Common NameAMTR_s00080p00150020, LOC18433119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Nin-like
Protein Properties Length: 911aa    MW: 101969 Da    PI: 7.0067
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00080.66genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK86.71.9e-27610660252
                                   RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                              ek++s+ +l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  evm_27.model.AmTr_v1.0_scaffold00080.66 610 EKSVSMVVLQQYFAGSLKDAAKSVGVCPTTLKRICRQHGIRRWPSRKINKV 660
                                              6899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.028593680IPR003035RWP-RK domain
PfamPF020424.5E-24613660IPR003035RWP-RK domain
PROSITE profilePS5174516.106814898IPR000270PB1 domain
SuperFamilySSF542773.11E-12814898No hitNo description
SMARTSM006661.1E-13814898IPR000270PB1 domain
PfamPF005646.8E-13814893IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.7E-14815895No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MASSSLLCSG GEAAETMAES CNFFEFMDSI GGYYSLDLDA SDFQASFPTF TPQSSNYQVF  60
SLFSLPQSSN LEEEILDKWV SSDSSQLFDS GFSPIDISEP GENIIQGPGL MKVHAISGKP  120
IENLRQNKAN EIDVKLENRG EKPFFDSNES CVLKERMMLA IRNFKDSAEH NVLVQVWVPI  180
KNGDKFVLTT SGQPFALDHQ STSLLRYRTV SLTYAFSTDK EDEGNLGLPG RVFQKKRPEW  240
TPNVQFYSRK EYPRLNHALL YDVRGSLAVP IFEASGESCI GVVELITTLQ KISYAPEVDK  300
VCKALEAVNF KVPEIVDHPN VQISNDGHRA ALAEIRKILI SVCDIHNIPL AQTWVPCYYC  360
DVKNYVAVMK DNDSCLKIGD RKVCMSANNA AFCVNEAHVW GFRDACSEHH LKGSEGIVGG  420
AFTSKGPCFC DNICSFSKTE YPLVHYAYMF GLSGSLALHL QSLYAGSGDY VLEIFLPLNC  480
KGKAEQRKLL VSMLATIKQC CQNSFLVLSK EVHDEKSVQM IEICRNVENG GNIPGSHKNC  540
QGHHEMYQEQ ERSCKSTLHE TSGHRDLLRQ DTMNYNVKLS DIEAKRCEVN SVGEIKFGRR  600
GLERGRGKLE KSVSMVVLQQ YFAGSLKDAA KSVGVCPTTL KRICRQHGIR RWPSRKINKV  660
NNSLRKLQGE IESVRGIDGP FTVTSFTNSS ISWPAPSDHK TFTTTHCTRP IAMEAKCLDS  720
DSEPIIDKLS KYNCYFSDAI PGQRDIIAPR DESMERPMTS EFCLSSFSPQ SSDPSFALEY  780
KKRFCTERPK SEHMQIARSV SCKDLSELPH GLEWVTIKTS YQDDMVIRFR LSSGSGIFDL  840
HREVSKRFKM EVGAFGIKYF DNDKGNWVLL SCDADLHKCI DASTSSGARV IRLSMTFSNQ  900
ATRMREAQLI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843278.10.0protein NLP7 isoform X1
RefseqXP_011622933.10.0protein NLP7 isoform X1
TrEMBLW1PAI60.0W1PAI6_AMBTC; Uncharacterized protein
STRINGERN049530.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-165NIN like protein 7
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]