PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00066.150
Common NameAMTR_s00066p00148680, LOC18448644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Nin-like
Protein Properties Length: 1026aa    MW: 113580 Da    PI: 6.547
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00066.150genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.53.1e-29632682252
                                    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                               e +isl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  evm_27.model.AmTr_v1.0_scaffold00066.150 632 ERNISLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 682
                                               789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041614702IPR003035RWP-RK domain
PfamPF020422.8E-26634682IPR003035RWP-RK domain
SuperFamilySSF542777.52E-229231011No hitNo description
Gene3DG3DSA:3.10.20.2401.0E-219241006No hitNo description
PROSITE profilePS5174523.8099271009IPR000270PB1 domain
SMARTSM006663.2E-179271009IPR000270PB1 domain
CDDcd064072.63E-309281008No hitNo description
PfamPF005641.2E-159281008IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1026 aa     Download sequence    Send to blast
MDHLFVHRAP GTGPWCSSQG VPSVPDNMGV EDSFSFSEIM DFDSYVEPSV AGDQVSPVYG  60
FNNSYPIGDV PTYYAPVSSN PNSNPATGNS LVGFGVPLEY RDPVTNPTAS FYPRPFSPEE  120
EVIAGAPYFK TNTKSDAYDR KNTYQYVYKS PVDPTKASCY RPSVRQEGDN GSNCGSFVGQ  180
SEHEEILKRN INTKEWMVKQ MDSRQNFTIP RSPGLILSEK LLKALSLFRG YCGGNILAQV  240
WMPVRQGDQY VLTTCEQPYL LDQILAGYRE VSRGFFFSAK GTEGAFPGLP GRVFISGLPE  300
WTPDVSYYKR AEYLRADHAR RNEVHGSLAL PVFEPHDSSC LAVLELVTTK KKASFGEEME  360
NICHALQAVN LRSREAKVHF QIISENRKAA LAEILDLLRA VCHAHKLPLA QTWTPCKQKF  420
MPRLEDGETL EKVLLSIEKS ACYANDPQLD GFMDACAENH LEKGRGIVGK ALQSNKPFFS  480
KDVKEYDILE YPLAHHARRF ALCAAVAIRL RSSHTSDDDY VLEFFLPLNC TGSLEQQLVL  540
NNLSSTIQRI CRSLRTVSEA ELAECNTVGV FGKDERKSSS LMGMHGKCSD PPLSKAMGIQ  600
NPVLDKVEGD VDHEQTTTDS KRQFERKRNT AERNISLSVL QQYFSGSLKD AAKSIGVCPT  660
TLKRICRQHG ISRWPSRKIN KVNRSLRKLQ IVIDSVQGAE GSLKFDVLTG GFVTGASKLH  720
DGDNQIPFST SPKSSPIVLL NVTPKKKVRE EAASSIEEIR KSEINFQSLH SNKTELSGTP  780
SLPMAFKIEK DPVSVSPIGV IDEPKAATSF CSGLEQMPWA FSQTNLRSSF VGRETCERMD  840
TNKDHMSIES SECLIRTRSS SSLAAVDELE NGVYAMDGMV ENNQPSSSGM TDSSNSSGSM  900
INGSATSSPT MPVSCKSKVY LRDGSSRVTV KATYKDDVVR FKFLPCLGYF QLFEEVGRRF  960
KLSIGTFQLK YLDDEEEWVL LMNDSDLNEC LEILESYGAH SVKLMVRDLP CVMGSSEGST  1020
CAPLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858767.10.0protein NLP9
TrEMBLU5DCH80.0U5DCH8_AMBTC; Uncharacterized protein
STRINGERN202340.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]