PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00063.31
Common NameAMTR_s00063p00135060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HB-other
Protein Properties Length: 262aa    MW: 30262.7 Da    PI: 6.4299
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00063.31genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox469.2e-152277257
                                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                 Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                             +kR   t++qle+Le+++++++yp ++ + + A k gL+ +q++vWF  rR k+kk
  evm_27.model.AmTr_v1.0_scaffold00063.31 22 KKRKLKTPSQLEALEKFYNEHKYPPESLKVQFAWKWGLSMKQIQVWFWHRRLKDKK 77
                                             89****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-161277IPR009057Homeodomain-like
SuperFamilySSF466891.54E-161480IPR009057Homeodomain-like
PROSITE profilePS5007115.0941878IPR001356Homeobox domain
SMARTSM003898.1E-112082IPR001356Homeobox domain
PfamPF000462.0E-122277IPR001356Homeobox domain
CDDcd000861.10E-122277No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MNVLESCNIA SDDDMIFHEK NKKRKLKTPS QLEALEKFYN EHKYPPESLK VQFAWKWGLS  60
MKQIQVWFWH RRLKDKKVFK EDALANGEQD TQRIRQDLVS SSKQGESKNF NLSKVESQRF  120
NDPSLTSEPR HRYVLTRTCS AMHNNASSES DSASEDRSSL QTEDHYDMKP LIYSSLHNNY  180
NEYVNMDGKV RRGYAVLDED IYFQENGEDP TISSVKRKLG RHYHEDGPML GIVFQPLPPG  240
AFDASFEDSR SGLVAKIEEE G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627223.20.0homeobox-DDT domain protein RLT1 isoform X3
TrEMBLU5D1D70.0U5D1D7_AMBTC; Uncharacterized protein
STRINGERN162490.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8823814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-26HB-other family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]