PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00059.206 | ||||||||
Common Name | AMTR_s00059p00187950 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 167aa MW: 19690.3 Da PI: 9.7783 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 160.2 | 8e-50 | 13 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 l+pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+++ +ekew+f+++rd+ky+ evm_27.model.AmTr_v1.0_scaffold00059.206 13 LMPGFRFHPTEEELVEFYLRRKVEGKRFSV-ELITFLDLYRYDPWELPAHAVIGEKEWFFYVPRDRKYR 80 689***************************.89***************8777899************** PP NAM 70 tgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+r+nr+t+sgyWkatg d+ + + +++ +glkktLvfy+g+apkg++++W+m+eyrl evm_27.model.AmTr_v1.0_scaffold00059.206 81 NGDRPNRVTTSGYWKATGADRMIRGErSSRPIGLKKTLVFYSGKAPKGTRSSWIMNEYRL 140 ***********************99857788***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-54 | 11 | 146 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.753 | 13 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.4E-26 | 15 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MNDAEKEGGE EVLMPGFRFH PTEEELVEFY LRRKVEGKRF SVELITFLDL YRYDPWELPA 60 HAVIGEKEWF FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RMIRGERSSR PIGLKKTLVF 120 YSGKAPKGTR SSWIMNEYRL PQHETTSADH NHHIFQKQKT YKLEQG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-54 | 13 | 140 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-54 | 13 | 140 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-54 | 13 | 140 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-54 | 13 | 140 | 17 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swm_B | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swm_C | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swm_D | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swp_A | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swp_B | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swp_C | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
3swp_D | 5e-54 | 13 | 140 | 20 | 145 | NAC domain-containing protein 19 |
4dul_A | 4e-54 | 13 | 140 | 17 | 142 | NAC domain-containing protein 19 |
4dul_B | 4e-54 | 13 | 140 | 17 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011627776.1 | 1e-118 | NAC domain-containing protein 35 isoform X1 | ||||
Swissprot | Q9ZVP8 | 2e-87 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | U5CWF8 | 1e-120 | U5CWF8_AMBTC; Uncharacterized protein | ||||
STRING | ERN17661 | 1e-121 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 8e-90 | NAC domain containing protein 35 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00059.206 |
Publications ? help Back to Top | |||
---|---|---|---|
|