PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.115
Common NameAMTR_s00058p00147810, LOC18434787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Nin-like
Protein Properties Length: 994aa    MW: 110070 Da    PI: 4.8987
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.115genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.94.3e-28642693152
                                    RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                               aek+isle+l++yF++++kd Ak++gvc+T+LKriCRq+GI+RWP+Rki+++
  evm_27.model.AmTr_v1.0_scaffold00058.115 642 AEKTISLEVLKQYFAGSLKDSAKSIGVCPTTLKRICRQHGISRWPSRKINKV 693
                                               589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2632713IPR003035RWP-RK domain
PfamPF020424.9E-24645693IPR003035RWP-RK domain
PROSITE profilePS5174521.426898980IPR000270PB1 domain
SuperFamilySSF542776.87E-21898984No hitNo description
SMARTSM006661.4E-19898980IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.3E-24898980No hitNo description
CDDcd064071.58E-35899979No hitNo description
PfamPF005647.7E-16899979IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 994 aa     Download sequence    Send to blast
MDLDLDMDGA WVNESTNEDV ASGYAFSPNC QELSFCSLSP SHNIPDFSQF PTQPDKTTET  60
QVTQQFEASS SLPKTMYNPE SYSPMWLFSD NSFPLKISEN DPQITIPGNI DPESGLKQEK  120
SIDLTNCDGS NGLPGPNHMM GLSEKNQTGG FIVISESNSN EKSDKASNNQ NWVVDERSES  180
DGSCVLKARM MQALRYFKES TEQHVLVQVW APVKNGDKYV LTTSGQPFVL DPHSNGLLQY  240
RTVSLMYVFS TDPEKDSDLG LPGRVFRKKL PEWTPNVQYY SSNEYARLTH AMHYNVRGTL  300
ALPVFEPLGQ SCVGVVELIM TAQKINYAPE VDKVCKALEA VNLKSSEILD HPNLQICNEG  360
RQAALAEILE IVTVVCETHS LPLAQTWVPC RHRSVLAHGG GSRKSCTSFD GSCMGQVCMS  420
TTDVAFYVVD AHMWGFRDAC SEHHLQKGQG VTGRAFESHR PRFSRDITQF SKTEYPLVHY  480
ARMFGLAGAL AICLRSTHTG SDDYILEFFL PPNCKDTTEQ QRLLDSLATT IQGCRRSLRV  540
VSDQELMEEN VLEIIEGSMN GGGDMMIEGE TGQNCANVHI TQESGEPHEN DELQLLEQQR  600
PSEVEVHKDD GKLINTEQEH AAAPLSKGKN VKKGLERRRG KAEKTISLEV LKQYFAGSLK  660
DSAKSIGVCP TTLKRICRQH GISRWPSRKI NKVNRSLSKL QRVIESVHGA EGAFNLPVAL  720
GPIPLSTDLK ASKEHSHHSV EKERETPPSK TLEEEHPNSQ VEPLIRIESD VHQQLGDVGY  780
TVHESKSKSD VGDEATEAPT SQGSCLSSPT SETQLNNLHT SLIHEIESFD GFRPIVDAGS  840
CKDLSSLCNM GTEDIPEEQL PEPNGVQEPL PLSLEPHPPF QPAIVSPFVQ ETQADIKSVA  900
VKASYKEDII RFRLRFTSGV VELNEEVAKR LKLEMGTFDI KYLDDDQEWV LLACDADLQE  960
CIDILMASMG HVIRLLVHDV VSNLGSSCES SGE*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844913.10.0protein NLP6
RefseqXP_020523225.10.0protein NLP6
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLW1PF370.0W1PF37_AMBTC; Uncharacterized protein
STRINGERN065880.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]