PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.101
Common NameAMTR_s00058p00137050, LOC18434773
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HB-other
Protein Properties Length: 1750aa    MW: 197041 Da    PI: 5.2685
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.101genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.51.8e-161771357
                                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                  Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                              kR   t+ qle Le+ ++ ++yps++ r++L++kl+Lt+rq ++WF+ rR k+++
  evm_27.model.AmTr_v1.0_scaffold00058.101 17 KRKMKTAVQLELLEKTYAIENYPSEALRADLSAKLDLTDRQLQMWFCHRRLKDRR 71
                                              89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-15672IPR009057Homeodomain-like
PROSITE profilePS5007115.8071272IPR001356Homeobox domain
SuperFamilySSF466891.11E-141373IPR009057Homeodomain-like
SMARTSM003892.2E-151476IPR001356Homeobox domain
CDDcd000863.91E-121772No hitNo description
PfamPF000464.2E-141771IPR001356Homeobox domain
PROSITE profilePS5082717.048563622IPR018501DDT domain
SMARTSM005715.1E-23563622IPR018501DDT domain
PfamPF027919.9E-17564619IPR018501DDT domain
PfamPF050661.3E-13745812IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.8E-9954998IPR028942WHIM1 domain
PfamPF156132.4E-1211371208IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1750 aa     Download sequence    Send to blast
MEKAEGEKKC PEDKTTKRKM KTAVQLELLE KTYAIENYPS EALRADLSAK LDLTDRQLQM  60
WFCHRRLKDR RKDEDGSSKR QKKAASEPSK DPDAMDSASR DDRSMASNIF VGMRKDVVPR  120
SSEMPMVKRF IDLQPSVENR VIAAIEAQLG EPLREDGPAL GVEFDPLPPG AFGSPLGQQM  180
LSGRLYDGKI YERQEAKPGM ASPPMPNMEH GFLQSSSSGK RKASGGNVHM VLPQVGTRTP  240
PLEYKFLPEQ PSVRPEAHER AATSSNSYDT PFEALGHRGP SLSTGGAFLH HSEPLASSYA  300
YPSQMVNVNR SSHGRHEHSY SQGSADYDSG QHKNSLAHFG SDPHVVPHPV LGLDNPYASS  360
DQLICADEDA SRMERKRKAE EARIAKEVEA HEKRIRKELE KQDLLKRKRE EQTRREMERY  420
DRERRKEEER LVRERQREEE RFQREQKREV VRRERFLQKE SLRAEKMRHK EELRREKEAA  480
RLKAANERAT ARRIARESME LVEDERLELM ELAASCKGLP SVVFLDMETL QNLELFKDKR  540
GAFPPRSVRL KEPFTIRPLK DSEENVANLL MVWRFLITFA DVLGLWPFTL DEFVQAFHDH  600
DSRLMGEIHI VLLKSIIKDI EDVARTPSVG TGANQNSAAN PGGGHPQIVE GAYAWGFDIR  660
SWQRHLNPLT WPEVLRQFAL SAGFGPRWKE KGPRQAYFRD ENEGHDGEDV VSTLRSGAAA  720
QNAVSMMHGK GISHLRKCRH RLTPGTVKFA AFYVLSLEGS KGLTILEVAD KIQKSGLRDL  780
TTSKTPEASI AAALSRDGNL FERTAPSTYC VRPAFRKDPA DRDAILQAAR EKIRQFQSGF  840
SDSEEAEKDL EDAEDVADEE FDIDEAEDPE IDDGLDGLQN SDKGLFSVNE EDKADQASTP  900
SEEEKSEQIK DKVGKTRGVL IDNSNDAKKA SILNGQPADE NINEQEDAEI DESHTGESWV  960
QGLTEGEYSD LSVEERLNAL VALIGVAIEG NSIRVVLEER LEAANALKRQ MWAEAQLDKR  1020
RMREEHYSKS QVSNFTGTKA EGVSNHNGAE GGQSPLPQVD NKGEEFFSAT KQDQSIDAQN  1080
VQSYLHNMLS EKNPTGQELA VGQDISPYQQ QAFAFEKSRA QLKAYIGHRA EELYVYRSLP  1140
LGQDRRRNRY WRFVTSSGSD PGCGRIFFES HDGCWRIIDT VEGFDALLAA LDIRGIRESH  1200
LYSMLQKIES SFKEVAKSNL YSMNPTEVTA IATKIESIDT ASCSVPKVEV DSPTSVVWDD  1260
SSDFWEQSKS FKIELGRTDL EKFNVLMRYE DYEKWLWTEC FNSSVVCALK YGKKRCTELL  1320
YTCEFCHNSF LAKDKHCSCC HGTFKKLDTK FSQHVADCEE KRKLELNWKL RRAFSSLSSR  1380
VRLVKAELAS IEVSIPSEAL KSHWTEAFRK SWGINLLSLT TAEELFQMLN LLEAAVVREC  1440
LSSSYETTKD LLESAKLGYP TDETSLQPGS VPLLPWIPQT TAALALRLME FDASIAYMMQ  1500
QKSHRDRESE EFVKVPSRFA VVRSIQEVDP MESPNQALHP NHEDNWTSEP RPLRGSGRGR  1560
GSGSGRGRGR GRGRSTRGGR GAGGSRAEAS GRLVGNGERA RHGRGGRKGR GRGRGRGRGL  1620
IRARVKPILE RRIEEEEEGR EVIDSKQKSE ESSSTGEEWV GEEATGEMMN YAMENEGVRS  1680
DESSEEEENE QESEDEFGDG GPKYGVGGDY DSKSEEVDGD ESGDEDEERD QNGEEEDEEE  1740
SGSISEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16472RRLKDRRKD
2405425KRKREEQTRREMERYDRERRK
316091618RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844899.10.0homeobox-DDT domain protein RLT2 isoform X2
TrEMBLW1PFU30.0W1PFU3_AMBTC; Uncharacterized protein
STRINGERN065740.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15771634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]