PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00057.99 | ||||||||
Common Name | AMTR_s00057p00121410, LOC18445162 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 151aa MW: 17284.2 Da PI: 10.3803 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 66.7 | 2.5e-21 | 27 | 61 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+nC+ttkTplWRrgp g+k+LCnaCG++yrk+++ evm_27.model.AmTr_v1.0_scaffold00057.99 27 CENCRTTKTPLWRRGPAGPKSLCNACGIKYRKMRR 61 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 4.2E-15 | 21 | 79 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 14.14 | 21 | 57 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.85E-13 | 24 | 61 | No hit | No description |
CDD | cd00202 | 1.36E-14 | 26 | 58 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.4E-16 | 26 | 60 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 1.0E-18 | 27 | 61 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 27 | 52 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MIDTCEQESS APVETNYWKM KENLKSCENC RTTKTPLWRR GPAGPKSLCN ACGIKYRKMR 60 RTILGLGGEE RENMKKRKRY GVEGEERESI KRRSEERESI KRRKRYGVSL KLRLMPLGGE 120 VLFHKQGKPV KEVEQAAVLL MALSCGTVYS * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 90 | 104 | KRRSEERESIKRRKR |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00554 | DAP | Transfer from AT5G49300 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006855367.1 | 1e-105 | GATA transcription factor 16 isoform X1 | ||||
TrEMBL | U5D329 | 1e-104 | U5D329_AMBTC; Uncharacterized protein | ||||
STRING | ERN16834 | 1e-104 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 4e-26 | GATA transcription factor 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00057.99 |
Entrez Gene | 18445162 |
Publications ? help Back to Top | |||
---|---|---|---|
|