PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00057.247
Common NameAMTR_s00057p00206030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HB-other
Protein Properties Length: 1031aa    MW: 113470 Da    PI: 8.6843
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00057.247genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.97.1e-0870126157
                                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                               +r+R  ++++ ++ ++++F  + ++s++e +e+++ +g+t +qV+ +F  +R + +k
  evm_27.model.AmTr_v1.0_scaffold00057.247  70 KRPRDLLNPKAVKYMQAVFSIKDTLSKKETREISALCGVTVTQVREFFASQRSRVRK 126
                                               799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.68567127IPR001356Homeobox domain
SuperFamilySSF466891.67E-769131IPR009057Homeodomain-like
SMARTSM003891.8E-469131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-770134IPR009057Homeodomain-like
CDDcd000867.48E-670126No hitNo description
PfamPF000462.8E-570126IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1031 aa     Download sequence    Send to blast
MERPKEVLFA ESDIGNSFES FERCLESQKE LFHYQIEQLE KIVASQCKLT GANPLSNEMA  60
AGALSIKIGK RPRDLLNPKA VKYMQAVFSI KDTLSKKETR EISALCGVTV TQVREFFASQ  120
RSRVRKLFRL TREKAMRNDN ACEASLDGPA TNSEHTIHAS EQPIEQPLED LVEQATSLNV  180
VKEDPSCSLQ GDVSPGIEPS DSNFLENIFS LMRKEETYAG QVKLMEWILQ IRNSAVLYWF  240
STKGGIVILA KWLSEAASEE QTTVLLVIFK VLCHLPFHKA LPVQISAILQ TVNKLRFYRT  300
SAHLLIILVR PSWSRINEIL SDGSWQSKID IPEEILAPTD EIPENCRKSE PPNSLKLLPN  360
ASDDSNRRLV RIIPSSQAKE RRKVLLVEQP SRKRANRNVQ VARAASEARA RPLSADDIQK  420
AKMRAVFMQG KHCNDGVHKS TQLLKPRVTK PPSLSQSRKK LNDSPLEEPD FEPTRPEVEP  480
LSRASQRIRD PESSGRVHDE PTRGSDLGSG ICGPLSDQLR QVQTAWRTPP EMRINCLWRV  540
GAGEKSKEME IQTERIRRER ETIYRFPYEI PPNPKEPWDV ELDYDDSLTL EIPSEQANSM  600
EAVEEDPQNA LEDTISQSLA ACSNKNPSDG NDPTGDTSSQ RSETNICSGS QAASINGTAG  660
PDLELLAVLL KNPELVFALT SGQGKNISNS DTVVLLDMLK ASNVGMGGTK QESGPSIPRQ  720
ALQSGGAITA SSSAKVALPE IRPSPSISPS NLGAPSHHTP PSGLLPCSHP APGAPSQHLT  780
PIPANPNQIL AHLNQIPAIS KQISVSPQRI LPMANQIPAT QTRIPVTLNQ SLATPSQNLS  840
SQGQIPGTLT PTAGKPNQDT VLSNQISATL NHIPATSSPV LPFRANPRHF PTNSNYFPAA  900
NSPPRATSNA PLLPLPSAGK TQPATGKVFP AKEGHLGFSD DFGSASRALS PIRNPGFPAK  960
TVSGIPNLPL ERGGPEFEVW SPERDPVWTV EHQWQERARG NFGRNLRPDR QWHHRGGRQR  1020
PGSRRRDRRF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627478.10.0homeobox protein LUMINIDEPENDENS isoform X1
TrEMBLU5D6D60.0U5D6D6_AMBTC; Uncharacterized protein
STRINGERN169820.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-155HB-other family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]