PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00053.185 | ||||||||
Common Name | AMTR_s00053p00228660 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 189aa MW: 21473 Da PI: 8.3226 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.2 | 2.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr+g+lKKA+ELS+LCdaeva+iifsstgkl+e++s evm_27.model.AmTr_v1.0_scaffold00053.185 9 KKIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSTGKLFEFPS 59 68***********************************************96 PP | |||||||
2 | K-box | 65.4 | 2e-22 | 89 | 167 | 17 | 95 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 +e+a L++ei +Lq + h++G++L +LslkeLq+Le+ L++++++++++K++llleq+e++q kek evm_27.model.AmTr_v1.0_scaffold00053.185 89 QVKEVAVLREEIGKLQMAHMHMMGKELLNLSLKELQHLENMLNEGITSVKDRKEKLLLEQLEQSQLKEK 157 4479***************************************************************** PP K-box 86 elqeenkaLr 95 ++ ++L+ evm_27.model.AmTr_v1.0_scaffold00053.185 158 RAAVSLNNLK 167 9987777776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.562 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.68E-34 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.95E-45 | 2 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.749 | 86 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.9E-14 | 90 | 168 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010047 | Biological Process | fruit dehiscence | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
GO:0060862 | Biological Process | negative regulation of floral organ abscission | ||||
GO:0060867 | Biological Process | fruit abscission | ||||
GO:0071365 | Biological Process | cellular response to auxin stimulus | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGRGKIEIKK IENATSRQVT FSKRRAGLLK KAQELSILCD AEVALIIFSS TGKLFEFPSS 60 GMKKTLARYN QCSDSSESSL VECDFEMQQV KEVAVLREEI GKLQMAHMHM MGKELLNLSL 120 KELQHLENML NEGITSVKDR KEKLLLEQLE QSQLKEKRAA VSLNNLKYEM FYSHLDSLCA 180 YANKLHEI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-24 | 1 | 78 | 1 | 78 | MEF2C |
5f28_B | 4e-24 | 1 | 78 | 1 | 78 | MEF2C |
5f28_C | 4e-24 | 1 | 78 | 1 | 78 | MEF2C |
5f28_D | 4e-24 | 1 | 78 | 1 | 78 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00508 | DAP | Transfer from AT5G13790 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011623002.1 | 1e-107 | MADS-box transcription factor 23 isoform X2 | ||||
Swissprot | Q39295 | 1e-60 | AGL15_BRANA; Agamous-like MADS-box protein AGL15 | ||||
TrEMBL | W1PB86 | 1e-133 | W1PB86_AMBTC; Uncharacterized protein | ||||
STRING | ERN05188 | 1e-134 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13790.1 | 3e-48 | AGAMOUS-like 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00053.185 |
Publications ? help Back to Top | |||
---|---|---|---|
|