PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00021.27 | ||||||||
Common Name | AMTR_s00021p00057700, LOC18442135 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 146aa MW: 16655.8 Da PI: 9.1616 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 119.8 | 1e-37 | 41 | 99 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +e++++cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grr++ + evm_27.model.AmTr_v1.0_scaffold00021.27 41 PENSVQCPRCKSKETKFCYFNNYNVNQPRHFCRGCQRYWTAGGALRNVPVGAGRRRKMQ 99 67899**************************************************9865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-24 | 41 | 96 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.7E-31 | 43 | 98 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.68 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 47 | 83 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MPKESVFKLF GKRIPINSEI EENQLQQREV EESDESRVRR PENSVQCPRC KSKETKFCYF 60 NNYNVNQPRH FCRGCQRYWT AGGALRNVPV GAGRRRKMQH LPQGEVSACG NDGGHVLIGG 120 NLFDQPGFRQ TGSRCSRMVF TFEEP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006852421.1 | 1e-104 | dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 1e-36 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | W1PZP4 | 1e-103 | W1PZP4_AMBTC; Uncharacterized protein | ||||
STRING | ERN13888 | 1e-104 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP38 | 17 | 445 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 5e-35 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00021.27 |
Entrez Gene | 18442135 |
Publications ? help Back to Top | |||
---|---|---|---|
|