PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00017.277 | ||||||||
Common Name | AMTR_s00017p00255350 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 189aa MW: 21612.1 Da PI: 4.6717 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 143.2 | 1.5e-44 | 7 | 131 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 lppGfrF+Ptdeelv +yL +k+++++++ ++i+e+diyk++Pw+Lp+++ +e++wyfF++r++++ evm_27.model.AmTr_v1.0_scaffold00017.277 7 LPPGFRFNPTDEELVLHYLIPKARHSTNTS-NIITEIDIYKFDPWQLPSEAMVGEQHWYFFCPRKRRQV 74 79************************9877.89***************8777899************** PP NAM 70 tgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +g+r+nr + sgyW atg+d++vls +++ vgl+k fy+g+ap+g+ t W+mhey evm_27.model.AmTr_v1.0_scaffold00017.277 75 KGSRSNRPAISGYWMATGTDTPVLS-GSKRVGLRKDWEFYSGKAPRGSITYWTMHEYL 131 *******8899**************.999****************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.75E-53 | 4 | 152 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.492 | 7 | 152 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-22 | 8 | 130 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGDENNLPPG FRFNPTDEEL VLHYLIPKAR HSTNTSNIIT EIDIYKFDPW QLPSEAMVGE 60 QHWYFFCPRK RRQVKGSRSN RPAISGYWMA TGTDTPVLSG SKRVGLRKDW EFYSGKAPRG 120 SITYWTMHEY LIIDADDCTN SEDWVLCHVY DKSCCSSSGD EGRELSCMDE IYASLDDFDD 180 ITYPLQGP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-52 | 6 | 158 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-52 | 6 | 158 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-52 | 6 | 158 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-52 | 6 | 158 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-52 | 6 | 158 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-52 | 6 | 158 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-52 | 6 | 158 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020524559.1 | 1e-141 | NAC transcription factor NAM-B2 | ||||
Swissprot | A0SPJ6 | 3e-57 | NAMB2_TRITD; NAC transcription factor NAM-B2 | ||||
TrEMBL | W1PM05 | 1e-139 | W1PM05_AMBTC; Uncharacterized protein | ||||
STRING | ERN08799 | 1e-140 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15500.1 | 4e-54 | NAC domain containing protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00017.277 |
Publications ? help Back to Top | |||
---|---|---|---|
|