PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00013.57 | ||||||||
Common Name | AMTR_s00013p00114420 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 6917.02 Da PI: 10.5644 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.5 | 1.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie rqvtf+kRrng+lKKA+ELS LCda+va+i+fsstg+l eyss evm_27.model.AmTr_v1.0_scaffold00013.57 9 KRIEKPNTRQVTFTKRRNGLLKKAFELSLLCDADVALIVFSSTGRLSEYSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.501 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.66E-28 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.10E-34 | 2 | 59 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRGKVELKR IEKPNTRQVT FTKRRNGLLK KAFELSLLCD ADVALIVFSS TGRLSEYSSQ 60 E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 4e-20 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 4e-20 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 4e-20 | 1 | 61 | 1 | 61 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011624863.1 | 4e-36 | MADS-box transcription factor 23 | ||||
Swissprot | Q40704 | 2e-26 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
TrEMBL | W1PQ00 | 3e-36 | W1PQ00_AMBTC; Uncharacterized protein | ||||
STRING | ERN09879 | 5e-37 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.2 | 1e-28 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00013.57 |
Publications ? help Back to Top | |||
---|---|---|---|
|