PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00009.309 | ||||||||
Common Name | AMTR_s00009p00259320, LOC18422909 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 292aa MW: 33203.8 Da PI: 8.1745 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.2 | 1.3e-52 | 7 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 lppGfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++Pw+Lp + +ekewyfFs+rd+ky+ evm_27.model.AmTr_v1.0_scaffold00009.309 7 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWQLPGVAVYGEKEWYFFSPRDRKYP 74 79**************************99.88***************65556799************* PP NAM 70 tgkrknratksgyWkatgkdkevlsk.....kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+r+nra+ sgyWkatg dk++ ++++vg+kk Lvfy+g+ pkg+kt+W+mheyrl evm_27.model.AmTr_v1.0_scaffold00009.309 75 NGSRPNRAAGSGYWKATGADKPIGLGpsksnNKKAVGIKKALVFYSGKPPKGQKTNWIMHEYRL 138 ***********************987777778888***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-63 | 4 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.701 | 7 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.6E-28 | 8 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 292 aa Download sequence Send to blast |
MTSDLELPPG FRFHPTDEEL VMHYLCRKCA SQPIAVPIIA EIDLYKYDPW QLPGVAVYGE 60 KEWYFFSPRD RKYPNGSRPN RAAGSGYWKA TGADKPIGLG PSKSNNKKAV GIKKALVFYS 120 GKPPKGQKTN WIMHEYRLAD VDRAPRKNNN LRLDDWVLCR IYNKKGSLEK ASREAKWGQP 180 PLESTVDRKP LVGPMPAPIV QPQLDVMQME GSDSAPRLYT DSSCSEHAPE LACEREVQSE 240 AKWREWDWNG MGLLDELLLN TSNSNPNPLP PLDQLKDPFY QDFLFYTQKP F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-76 | 3 | 170 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-76 | 3 | 170 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-76 | 3 | 170 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-76 | 3 | 170 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-76 | 3 | 170 | 16 | 174 | NAC domain-containing protein 19 |
3ulx_A | 2e-76 | 3 | 170 | 11 | 174 | Stress-induced transcription factor NAC1 |
4dul_A | 2e-76 | 3 | 170 | 13 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-76 | 3 | 170 | 13 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00121 | DAP | Transfer from AT1G01720 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006827706.1 | 0.0 | NAC domain-containing protein 48 | ||||
Swissprot | Q7F2L3 | 1e-113 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
TrEMBL | W1NH49 | 0.0 | W1NH49_AMBTC; Uncharacterized protein | ||||
STRING | ERM95122 | 0.0 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 1e-113 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00009.309 |
Entrez Gene | 18422909 |