PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm_27.model.AmTr_v1.0_scaffold00009.309

Common Name

AMTR_s00009p00259320, LOC18422909

Organism

Amborella trichopoda

Taxonomic ID

13333

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella

Family

NAC

Protein Properties

Length: 292aa MW: 33203.8 Da PI: 8.1745

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00009.309	genome	TAGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	169.2	1.3e-52	7	138	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69 lppGfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++Pw+Lp + +ekewyfFs+rd+ky+ evm_27.model.AmTr_v1.0_scaffold00009.309 7 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWQLPGVAVYGEKEWYFFSPRDRKYP 74 79************************99.88***********65556799********* PP NAM 70 tgkrknratksgyWkatgkdkevlsk.....kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+r+nra+ sgyWkatg dk++ ++++vg+kk Lvfy+g+ pkg+kt+W+mheyrl evm_27.model.AmTr_v1.0_scaffold00009.309 75 NGSRPNRAAGSGYWKATGADKPIGLGpsksnNKKAVGIKKALVFYSGKPPKGQKTNWIMHEYRL 138 *******************987777778888*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.44E-63	4	164	IPR003441	NAC domain
PROSITE profile	PS51005	60.701	7	164	IPR003441	NAC domain
Pfam	PF02365	6.6E-28	8	138	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 292 aa Download sequence Send to blast
MTSDLELPPG FRFHPTDEEL VMHYLCRKCA SQPIAVPIIA EIDLYKYDPW QLPGVAVYGE 60 KEWYFFSPRD RKYPNGSRPN RAAGSGYWKA TGADKPIGLG PSKSNNKKAV GIKKALVFYS 120 GKPPKGQKTN WIMHEYRLAD VDRAPRKNNN LRLDDWVLCR IYNKKGSLEK ASREAKWGQP 180 PLESTVDRKP LVGPMPAPIV QPQLDVMQME GSDSAPRLYT DSSCSEHAPE LACEREVQSE 240 AKWREWDWNG MGLLDELLLN TSNSNPNPLP PLDQLKDPFY QDFLFYTQKP F*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-76	3	170	13	171	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-76	3	170	13	171	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-76	3	170	13	171	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-76	3	170	13	171	NO APICAL MERISTEM PROTEIN
3swm_A	2e-76	3	170	16	174	NAC domain-containing protein 19
3swm_B	2e-76	3	170	16	174	NAC domain-containing protein 19
3swm_C	2e-76	3	170	16	174	NAC domain-containing protein 19
3swm_D	2e-76	3	170	16	174	NAC domain-containing protein 19
3swp_A	2e-76	3	170	16	174	NAC domain-containing protein 19
3swp_B	2e-76	3	170	16	174	NAC domain-containing protein 19
3swp_C	2e-76	3	170	16	174	NAC domain-containing protein 19
3swp_D	2e-76	3	170	16	174	NAC domain-containing protein 19
3ulx_A	2e-76	3	170	11	174	Stress-induced transcription factor NAC1
4dul_A	2e-76	3	170	13	171	NAC domain-containing protein 19
4dul_B	2e-76	3	170	13	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269\|PubMed:17587305, ECO:0000269\|PubMed:18273684, ECO:0000269\|PubMed:19453457, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269\|PubMed:11332734, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006827706.1	0.0	NAC domain-containing protein 48
Swissprot	Q7F2L3	1e-113	NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBL	W1NH49	0.0	W1NH49_AMBTC; Uncharacterized protein
STRING	ERM95122	0.0	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-113	NAC family protein

Link Out ? help Back to Top
Phytozome	evm_27.model.AmTr_v1.0_scaffold00009.309
Entrez Gene	18422909

Publications ? help Back to Top
Xiong L,Lee MW,Qi M,Yang Y Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohnishi T, et al. OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] Hu H, et al. Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] Kim MJ, et al. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] Chung PJ,Kim JK Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] Peng HF, et al. Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kim MJ, et al. Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] Gupta SK, et al. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] Nakashima K, et al. Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] Amborella Genome Project The Amborella genome and the evolution of flowering plants. Science, 2013. 342(6165): p. 1241089 [PMID:24357323] Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] Qian B, et al. Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] Shiriga K, et al. Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] Farooq MA,Detterbeck A,Clemens S,Dietz KJ Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] Lee DK, et al. The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643]