PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm_27.model.AmTr_v1.0_scaffold00004.51 | ||||||||
Common Name | AMTR_s00004p00067720 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 105aa MW: 12064.5 Da PI: 9.8404 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 76.6 | 2.9e-24 | 8 | 65 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dg+ WrKYGqK +++ + rsY++C ++C ++k+ve +++dp+ + ++Y g+H h+ evm_27.model.AmTr_v1.0_scaffold00004.51 8 EDGFVWRKYGQKFIRNIRKNRSYFKCQKKSCGARKRVEWCNSDPQNLRVIYDGSHSHP 65 7********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 21.448 | 2 | 67 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.45E-23 | 4 | 67 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 5.9E-25 | 5 | 67 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.0E-23 | 7 | 66 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.0E-22 | 8 | 65 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MDRVCMPEDG FVWRKYGQKF IRNIRKNRSY FKCQKKSCGA RKRVEWCNSD PQNLRVIYDG 60 SHSHPPPISS KTSDDDHQNP SSSIANQYNL LTQVLRGLND TTTT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-14 | 4 | 67 | 14 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-14 | 4 | 67 | 14 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006488951.1 | 3e-35 | probable WRKY transcription factor 23 | ||||
Refseq | XP_024047358.1 | 3e-35 | probable WRKY transcription factor 23 | ||||
TrEMBL | W1NEF1 | 5e-73 | W1NEF1_AMBTC; Uncharacterized protein | ||||
STRING | ERM93535 | 8e-74 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49520.1 | 6e-17 | WRKY DNA-binding protein 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm_27.model.AmTr_v1.0_scaffold00004.51 |
Publications ? help Back to Top | |||
---|---|---|---|
|