PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G65080.2

Common Name

AGL68, MAF5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 197aa MW: 22509.1 Da PI: 10.2648

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G65080.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	69.5	3e-22	9	56	1	48
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krienks rqvtf+kRrng++ KA LS+LC+ va+ i+sstgkly AT5G65080.2 9 KRIENKSSRQVTFCKRRNGLMEKARQLSILCGSSVALFIVSSTGKLYN 56 79********************************************97 PP
2	K-box	40.8	9.4e-15	80	163	12	98
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ e +q++ k+ +e qr++ +G++ s++ L ++e+qL+++l+ iR++K+ell+e +++lq kek l+e+nk L +++ AT5G65080.2 80 QDLEDKTQDYLSHKELLEIVQRKIEEAKGDN---VSIESLISMEEQLKSALSVIRARKTELLMELVKNLQDKEKLLKEKNKVLASEV 163 4567788999999999999********86...69********************************************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	27.698	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-31	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-23	1	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.4E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.6E-21	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.4E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.4E-23	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.95	79	172	IPR002487	Transcription factor, K-box
Pfam	PF01486	2.0E-10	93	162	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009910	Biological Process	negative regulation of flower development
GO:0010048	Biological Process	vernalization response
GO:0048587	Biological Process	regulation of short-day photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 197 aa Download sequence Send to blast
MGRRRVEIKR IENKSSRQVT FCKRRNGLME KARQLSILCG SSVALFIVSS TGKLYNSSSG 60 DRVVYVSWKR KNFTIFLSWQ DLEDKTQDYL SHKELLEIVQ RKIEEAKGDN VSIESLISME 120 EQLKSALSVI RARKTELLME LVKNLQDKEK LLKEKNKVLA SEVGKLKKIL ETGDERAVMS 180 PENSSGHSPP ETLPLLK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	5e-15	1	61	1	61	MEF2C
5f28_B	5e-15	1	61	1	61	MEF2C
5f28_C	5e-15	1	61	1	61	MEF2C
5f28_D	5e-15	1	61	1	61	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.28687	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42568780	0.0
Genevisible	247224_at	0.0
Expression Atlas	AT5G65080	-
AtGenExpress	AT5G65080	-
ATTED-II	AT5G65080	-

Functional Description ? help Back to Top
Source	Description
TAIR	Is upregulated during vernalization and regulates flowering time. Encodes MADS-domain protein. Two variants encoding proteins of 198 and 184 amino acids have been reported.
UniProt	Transcription factor involved in the negative regulation of flowering time in short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering, particularly in the cv. Landsberg erecta background. In non-inductive photoperiods (e.g. short days), required for flowering through VIL2-mediated maintenance of the epigenetically repressed state of MAF5 via H3K9me2 and plant homeodomain / polycomb repressive complex 2 (PHD-PRC2)-dependent H3K27me3. {ECO:0000269\|PubMed:12724541, ECO:0000269\|PubMed:18798874, ECO:0000269\|PubMed:18852898, ECO:0000269\|PubMed:20837520, ECO:0000269\|PubMed:21150261, ECO:0000269\|PubMed:21175890, ECO:0000269\|PubMed:21398257, ECO:0000269\|PubMed:22378382}.

Function -- GeneRIF ? help Back to Top
the repression of MAF5 by VIL2 provides a mechanism to promote flowering in noninductive photoperiods, which contributes to the facultative nature of the Arabidopsis photoperiodic response. [PMID: 20837520] MADS AFFECTING FLOWERING 4 (MAF4) and MAF5 are also upregulated in TEK knockdown plants. [PMID: 23733063] RING1A suppresses the expression of MAF4 and MAF5 through affecting H3K27me3 levels at these loci to regulate the floral transition [PMID: 24553292]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G65080.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by vernalization. Repressed by VIL2, AGL6, CLF, EMF2 and FIE via epigenetic chromatin H3K27me3 and H3K9me2 regulation during the vegetative development. {ECO:0000269\|PubMed:12724541}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G65080

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK175180	0.0	AK175180.1 Arabidopsis thaliana mRNA for MADS box protein FCL1, complete cds, clone: RAFL21-59-G18.
GenBank	AY141219	0.0	AY141219.1 Arabidopsis thaliana MADS-box protein AGL68 mRNA, complete cds.
GenBank	AY231455	0.0	AY231455.1 Arabidopsis thaliana MADS affecting flowering 5 variant I (MAF5) mRNA, complete cds.
GenBank	BT025268	0.0	BT025268.1 Arabidopsis thaliana At5g65080 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001078799.2	1e-140	K-box region/MADS-box transcription factor family protein
Swissprot	Q683D7	1e-113	MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBL	A0A2H1ZE96	1e-139	A0A2H1ZE96_ARATH; K-box region/MADS-box transcription factor family protein
STRING	AT5G65080.1	1e-111	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT5G65080.2
Entrez Gene	836632
iHOP	AT5G65080
wikigenes	AT5G65080

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold. Plant Cell, 2003. 15(5): p. 1159-69 [PMID:12724541] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Albert VA, et al. Floral gene resources from basal angiosperms for comparative genomics research. BMC Plant Biol., 2005. 5: p. 5 [PMID:15799777] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Czechowski T,Stitt M,Altmann T,Udvardi MK,Scheible WR Genome-wide identification and testing of superior reference genes for transcript normalization in Arabidopsis. Plant Physiol., 2005. 139(1): p. 5-17 [PMID:16166256] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Deal RB,Topp CN,McKinney EC,Meagher RB Repression of flowering in Arabidopsis requires activation of FLOWERING LOCUS C expression by the histone variant H2A.Z. Plant Cell, 2007. 19(1): p. 74-83 [PMID:17220196] Bieniawska Z, et al. Analysis of the sucrose synthase gene family in Arabidopsis. Plant J., 2007. 49(5): p. 810-28 [PMID:17257168] Bieniawska Z, et al. Disruption of the Arabidopsis circadian clock is responsible for extensive variation in the cold-responsive transcriptome. Plant Physiol., 2008. 147(1): p. 263-79 [PMID:18375597] Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Falkenberg B, et al. Transcription factors relevant to auxin signalling coordinate broad-spectrum metabolic shifts including sulphur metabolism. J. Exp. Bot., 2008. 59(10): p. 2831-46 [PMID:18596113] Li WX, et al. The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance. Plant Cell, 2008. 20(8): p. 2238-51 [PMID:18682547] Xu L, et al. The E2 ubiquitin-conjugating enzymes, AtUBC1 and AtUBC2, play redundant roles and are involved in activation of FLC expression and repression of flowering in Arabidopsis thaliana. Plant J., 2009. 57(2): p. 279-88 [PMID:18798874] Cao Y,Dai Y,Cui S,Ma L Histone H2B monoubiquitination in the chromatin of FLOWERING LOCUS C regulates flowering time in Arabidopsis. Plant Cell, 2008. 20(10): p. 2586-602 [PMID:18849490] Jiang D,Wang Y,Wang Y,He Y Repression of FLOWERING LOCUS C and FLOWERING LOCUS T by the Arabidopsis Polycomb repressive complex 2 components. PLoS ONE, 2008. 3(10): p. e3404 [PMID:18852898] Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster. Mol. Biol. Evol., 2009. 26(3): p. 699-711 [PMID:19139056] Kim DH,Sung S The Plant Homeo Domain finger protein, VIN3-LIKE 2, is necessary for photoperiod-mediated epigenetic regulation of the floral repressor, MAF5. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(39): p. 17029-34 [PMID:20837520] Kim DH,Sung S Role of VIN3-LIKE 2 in facultative photoperiodic flowering response in Arabidopsis. Plant Signal Behav, 2010. 5(12): p. 1672-3 [PMID:21150261] Yoo SK,Wu X,Lee JS,Ahn JH AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis. Plant J., 2011. 65(1): p. 62-76 [PMID:21175890] Yu CW, et al. HISTONE DEACETYLASE6 interacts with FLOWERING LOCUS D and regulates flowering in Arabidopsis. Plant Physiol., 2011. 156(1): p. 173-84 [PMID:21398257] Yun JY,Tamada Y,Kang YE,Amasino RM Arabidopsis trithorax-related3/SET domain GROUP2 is required for the winter-annual habit of Arabidopsis thaliana. Plant Cell Physiol., 2012. 53(5): p. 834-46 [PMID:22378382] Xu Y,Gan ES,Ito T The AT-hook/PPC domain protein TEK negatively regulates floral repressors including MAF4 and MAF5. Plant Signal Behav, 2014. [PMID:23733063] Shen L, et al. The putative PRC1 RING-finger protein AtRING1A regulates flowering through repressing MADS AFFECTING FLOWERING genes in Arabidopsis. Development, 2014. 141(6): p. 1303-12 [PMID:24553292] Liu B, et al. Interplay of the histone methyltransferases SDG8 and SDG26 in the regulation of transcription and plant flowering and development. Biochim. Biophys. Acta, 2016. 1859(4): p. 581-90 [PMID:26854085] Gong X,Shen L,Peng YZ,Gan Y,Yu H DNA Topoisomerase Iα Affects the Floral Transition. Plant Physiol., 2017. 173(1): p. 642-654 [PMID:27837087] Cui Z, et al. SKIP controls flowering time via the alternative splicing of SEF pre-mRNA in Arabidopsis. BMC Biol., 2017. 15(1): p. 80 [PMID:28893254]