Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 63 | 3.2e-20 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
krienks rqvtfskRr+g++ KA LS+LC+ +av+ +s +gkly+
AT5G65060.2 9 KRIENKSSRQVTFSKRRKGLIEKARQLSILCESSIAVVAVSGSGKLYD 56
79********************************************96 PP
|
2 | K-box | 38.1 | 6.3e-14 | 102 | 153 | 47 | 98 |
K-box 47 slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
s+ L ++e+qLe++l+ iR+kK+el++e ++ lq++ek l een+ L +++
AT5G65060.2 102 SVDSLISMEEQLETALSVIRAKKTELMMEDMKSLQEREKLLIEENQILASQV 153
56789*******************************************9987 PP
|
Publications
? help Back to Top |
- Alvarez-Buylla ER, et al.
MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes. Plant J., 2000. 24(4): p. 457-66 [PMID:11115127] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL
Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold. Plant Cell, 2003. 15(5): p. 1159-69 [PMID:12724541] - Parenicová L, et al.
Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] - Kofuji R, et al.
Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] - Scheible WR, et al.
Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] - Albert VA, et al.
Floral gene resources from basal angiosperms for comparative genomics research. BMC Plant Biol., 2005. 5: p. 5 [PMID:15799777] - de Folter S, et al.
Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] - Wang J,Tian L,Lee HS,Chen ZJ
Nonadditive regulation of FRI and FLC loci mediates flowering-time variation in Arabidopsis allopolyploids. Genetics, 2006. 173(2): p. 965-74 [PMID:16547097] - Timms L, et al.
Analyses of synteny between Arabidopsis thaliana and species in the Asteraceae reveal a complex network of small syntenic segments and major chromosomal rearrangements. Genetics, 2006. 173(4): p. 2227-35 [PMID:16783026] - Conte MG,Gaillard S,Droc G,Perin C
Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] - Cao Y,Dai Y,Cui S,Ma L
Histone H2B monoubiquitination in the chromatin of FLOWERING LOCUS C regulates flowering time in Arabidopsis. Plant Cell, 2008. 20(10): p. 2586-602 [PMID:18849490] - Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD
Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster. Mol. Biol. Evol., 2009. 26(3): p. 699-711 [PMID:19139056] - Severing EI, et al.
Predicting the impact of alternative splicing on plant MADS domain protein function. PLoS ONE, 2012. 7(1): p. e30524 [PMID:22295091] - Rosloski SM, et al.
Functional analysis of splice variant expression of MADS AFFECTING FLOWERING 2 of Arabidopsis thaliana. Plant Mol. Biol., 2013. 81(1-2): p. 57-69 [PMID:23111501] - Xiao J, et al.
Requirement of histone acetyltransferases HAM1 and HAM2 for epigenetic modification of FLC in regulating flowering in Arabidopsis. J. Plant Physiol., 2013. 170(4): p. 444-51 [PMID:23273925] - Suter L,Rüegg M,Zemp N,Hennig L,Widmer A
Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis. Plant Physiol., 2014. 166(4): p. 1928-42 [PMID:25339407] - Nasim Z,Fahim M,Ahn JH
Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay. Front Plant Sci, 2017. 8: p. 191 [PMID:28261246]
|