PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G62165.2 | ||||||||
Common Name | AGL42, FYF, MTG10.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 210aa MW: 24673.4 Da PI: 9.957 | ||||||||
Description | AGAMOUS-like 42 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.1 | 5.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRrng+lKKA+ELSvLCda+ ++iifs++g+lye+ss AT5G62165.2 9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQLSLIIFSQRGRLYEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 66.9 | 6.7e-23 | 77 | 170 | 4 | 97 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++++ ++ + ++l+qe++ + +ie L+ +R+llG+++ s+sl+eLq++ +qL++sl k+R++K +l++eq+e+l+ kek+l een +L++k AT5G62165.2 77 ETSNHDSQIHLQQLKQEASHMITKIELLEFHKRKLLGQGIASCSLEELQEIDSQLQRSLGKVRERKAQLFKEQLEKLKAKEKQLLEENVKLHQK 170 34444788899******************999************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.959 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.36E-33 | 3 | 86 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.66E-43 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.6E-22 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.146 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020149 | anatomy | quiescent center | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQLSLIIFSQ RGRLYEFSSS 60 DMQKTIERYR KYTKDHETSN HDSQIHLQQL KQEASHMITK IELLEFHKRK LLGQGIASCS 120 LEELQEIDSQ LQRSLGKVRE RKAQLFKEQL EKLKAKEKQL LEENVKLHQK NVINPWRGSS 180 TDQQQEKYKV IDLNLEVETD LFIGLPNRNC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
5f28_A | 7e-22 | 1 | 82 | 1 | 83 | MEF2C |
5f28_B | 7e-22 | 1 | 82 | 1 | 83 | MEF2C |
5f28_C | 7e-22 | 1 | 82 | 1 | 83 | MEF2C |
5f28_D | 7e-22 | 1 | 82 | 1 | 83 | MEF2C |
6c9l_A | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.26394 | 0.0 | root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 247469_at | 0.0 | ||||
Expression Atlas | AT5G62165 | - | ||||
AtGenExpress | AT5G62165 | - | ||||
ATTED-II | AT5G62165 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a MADS box transcription factor. Expressed in quiescent center. | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G62165.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G48150 | |||||
IntAct | Search Q9FIS1 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:21609362}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G62165 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY054220 | 0.0 | AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
GenBank | AY065206 | 0.0 | AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
GenBank | AY066035 | 0.0 | AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
GenBank | AY096509 | 0.0 | AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
GenBank | AY141213 | 0.0 | AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001032123.1 | 1e-152 | AGAMOUS-like 42 | ||||
Refseq | NP_568952.1 | 1e-152 | AGAMOUS-like 42 | ||||
Refseq | NP_851247.1 | 1e-152 | AGAMOUS-like 42 | ||||
Swissprot | Q9FIS1 | 1e-153 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1J3H203 | 1e-131 | A0A1J3H203_NOCCA; MADS-box protein SOC1 | ||||
STRING | AT5G62165.1 | 1e-151 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G62165.2 |
Entrez Gene | 836337 |
iHOP | AT5G62165 |
wikigenes | AT5G62165 |