PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G61420.2

Common Name

AtMYB28, HAG1, MFB13.22, MYB28, PMG1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 366aa MW: 41133.5 Da PI: 5.9758

Description

myb domain protein 28

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G61420.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.1	4.3e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTteEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl AT5G61420.2 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	48.1	2.7e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ eE+++++ +++ G++ W+ Iar+++ +Rt++++k++w+++l AT5G61420.2 67 RGEFSSEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112 899*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.579	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.35E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	3.6E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	4.59E-11	16	61	No hit	No description
PROSITE profile	PS51294	24.196	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.7E-25	65	116	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-14	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	1.23E-10	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009625	Biological Process	response to insect
GO:0009682	Biological Process	induced systemic resistance
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010438	Biological Process	cellular response to sulfur starvation
GO:0010439	Biological Process	regulation of glucosinolate biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0050832	Biological Process	defense response to fungus
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0006325	anatomy	inflorescence node
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009049	anatomy	inflorescence
PO:0009052	anatomy	flower pedicel
PO:0009066	anatomy	anther
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020121	anatomy	lateral root
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 366 aa Download sequence Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PQKAGLKRCG KSCRLRWTNY 60 LKPEIKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLMEQG 120 IDPVTHKPLA SSSNPTVDEN LNSPNASSSD KQYSRSSSMP FLSRPPPSSC NMVSKVSELS 180 SNDGTPIQGS SLSCKKRFKK SSSTSRLLNK VAAKATSIKD ILSASMEGSL SATTISHASF 240 FNGFTEQIRN EEDSSNTSLT NTLAEFDPFS PSSLYPEHEI NATSDLNMDQ DYDFSQFFEK 300 FGGDNHNEEN SMNDLLMSDV SQEVSSTSVD DQDNMVGNFE GWSNYLLDHT NFMYDTDSDS 360 LEKHFI

Sequence ? help Back to Top

Protein Sequence Length: 366 aa Download sequence Send to blast

MSRKPCCVGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLMEQG  120
IDPVTHKPLA SSSNPTVDEN LNSPNASSSD KQYSRSSSMP FLSRPPPSSC NMVSKVSELS  180
SNDGTPIQGS SLSCKKRFKK SSSTSRLLNK VAAKATSIKD ILSASMEGSL SATTISHASF  240
FNGFTEQIRN EEDSSNTSLT NTLAEFDPFS PSSLYPEHEI NATSDLNMDQ DYDFSQFFEK  300
FGGDNHNEEN SMNDLLMSDV SQEVSSTSVD DQDNMVGNFE GWSNYLLDHT NFMYDTDSDS  360
LEKHFI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-24	12	116	5	108	B-MYB
1h8a_C	1e-24	12	116	25	128	MYB TRANSFORMING PROTEIN
1mse_C	9e-25	12	116	2	105	C-Myb DNA-Binding Domain
1msf_C	9e-25	12	116	2	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.7460	0.0	root\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30697528	0.0
Genevisible	247549_at	0.0
Expression Atlas	AT5G61420	-
AtGenExpress	AT5G61420	-
ATTED-II	AT5G61420	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First present in stems, petioles and the main veins of true leaves in young seedlings. Later accumulates in leaves and present in lateral roots. During transition from the vegetative to the generative stage, preferentially expressed in inflorescence. {ECO:0000269\|PubMed:17521412}.
Uniprot	TISSUE SPECIFICITY: Expressed in generative organs, mature leaves and trichomes. {ECO:0000269\|PubMed:17521412, ECO:0000269\|PubMed:23115560}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative transcription factor (MYB28).
UniProt	Major regulator of short-chained aliphatic glucosinolates (GLSs) biosynthesis. Together with MYB29/HAG3 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae and Spodoptera exigua) by promoting glucosinolates. {ECO:0000269\|PubMed:17420480, ECO:0000269\|PubMed:17521412, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:18446225, ECO:0000269\|PubMed:20348214, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:23943862}.

Function -- GeneRIF ? help Back to Top
Myb28 is a positive regulator for basal-level production of aliphatic glucosinolates. [PMID: 17420480] We hypothesize that HAG1/MYB28 is a novel regulator of aliphatic glucosinolate biosynthesis that controls the response to biotic challenges [PMID: 17521412] MYB76 is not dependent on MYB28 and MYB29 for induction of aliphatic glucosinolates. [PMID: 20348214] Mutant plants deficient in camalexin, indole, or aliphatic glucosinolate biosynthesis were hypersusceptible to S. sclerotiorum, among them the myb28 mutant, which has a defect resulting in decreased production of long-chained aliphatic glucosinolates. [PMID: 21418358] MYB28 and MYB29 synergistically functioned in the glucose-induced biosynthesis of aliphatic glucosinolates, but MYB28 was predominant over MYB29. [PMID: 23329848] MYB28 expression was induced by sulfur deficiency, while the expression levels of MYB29 and MYB76 were positively correlated with sulfur concentration. [PMID: 23792303]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G61420.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by glucose, gibberellic acid (GA), jasmonic acid (JA) and salicylic acid (SA). Transiently induced in inflorescence by mechanical stimuli such as touch or wounding, including herbivory-wounding. Up-regulated by sulfur-deficient stress. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:17521412, ECO:0000269\|PubMed:23115560, ECO:0000269\|PubMed:23792303}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT2G01570 (R), AT5G07690 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT2G20610(A), AT3G01120(A), AT3G03780(A), AT3G57050(A), AT4G03060(A), AT4G13770(A), AT4G31500(R), AT5G23010(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G32640

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Low levels of aliphatic glucosinolates and decreased repressing effect of brassinosteroid on glucosinolates. {ECO:0000269\|PubMed:23580754}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G61420

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF175998	0.0	AF175998.1 Arabidopsis thaliana putative transcription factor (MYB28) mRNA, complete cds.
GenBank	AY519643	0.0	AY519643.1 Arabidopsis thaliana MYB transcription factor (At5g61420) mRNA, complete cds.
GenBank	BT028959	0.0	BT028959.1 Arabidopsis thaliana At5g61420 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200950.1	0.0	myb domain protein 28
Swissprot	Q9SPG2	0.0	MYB28_ARATH; Transcription factor MYB28
TrEMBL	A0A178UN88	0.0	A0A178UN88_ARATH; PMG1
STRING	AT5G61420.2	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3787	18	60
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G61420.2
Entrez Gene	836263
iHOP	AT5G61420
wikigenes	AT5G61420

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Hirai MY, et al. Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6478-83 [PMID:17420480] Gigolashvili T,Yatusevich R,Berger B,Müller C,Flügge UI The R2R3-MYB transcription factor HAG1/MYB28 is a regulator of methionine-derived glucosinolate biosynthesis in Arabidopsis thaliana. Plant J., 2007. 51(2): p. 247-61 [PMID:17521412] Earley KW,Shook MS,Brower-Toland B,Hicks L,Pikaard CS In vitro specificities of Arabidopsis co-activator histone acetyltransferases: implications for histone hyperacetylation in gene activation. Plant J., 2007. 52(4): p. 615-26 [PMID:17877703] Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] S A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates. PLoS ONE, 2007. 2(12): p. e1322 [PMID:18094747] Beekwilder J, et al. The impact of the absence of aliphatic glucosinolates on insect herbivory in Arabidopsis. PLoS ONE, 2008. 3(4): p. e2068 [PMID:18446225] Hou X, et al. Global identification of DELLA target genes during Arabidopsis flower development. Plant Physiol., 2008. 147(3): p. 1126-42 [PMID:18502975] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Malitsky S, et al. The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] Sawada Y, et al. Omics-based approaches to methionine side chain elongation in Arabidopsis: characterization of the genes encoding methylthioalkylmalate isomerase and methylthioalkylmalate dehydrogenase. Plant Cell Physiol., 2009. 50(7): p. 1181-90 [PMID:19493961] S A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis. Plant Physiol., 2010. 153(1): p. 348-63 [PMID:20348214] Servet C,Conde e Silva N,Zhou DX Histone acetyltransferase AtGCN5/HAG1 is a versatile regulator of developmental and inducible gene expression in Arabidopsis. Mol Plant, 2010. 3(4): p. 670-7 [PMID:20457643] M Differential effects of indole and aliphatic glucosinolates on lepidopteran herbivores. J. Chem. Ecol., 2010. 36(8): p. 905-13 [PMID:20617455] Stotz HU, et al. Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum. Plant J., 2011. 67(1): p. 81-93 [PMID:21418358] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Harper AL, et al. Associative transcriptomics of traits in the polyploid crop species Brassica napus. Nat. Biotechnol., 2012. 30(8): p. 798-802 [PMID:22820317] van de Mortel JE, et al. Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101. Plant Physiol., 2012. 160(4): p. 2173-88 [PMID:23073694] Frerigmann H,B Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.). PLoS ONE, 2012. 7(11): p. e48661 [PMID:23144921] Miao H, et al. Glucose signalling positively regulates aliphatic glucosinolate biosynthesis. J. Exp. Bot., 2013. 64(4): p. 1097-109 [PMID:23329848] Traka MH, et al. Genetic regulation of glucoraphanin accumulation in Benefort New Phytol., 2013. 198(4): p. 1085-95 [PMID:23560984] Guo R, et al. BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis. J. Exp. Bot., 2013. 64(8): p. 2401-12 [PMID:23580754] Li Y, et al. Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis. Plant Cell Physiol., 2013. 54(8): p. 1335-44 [PMID:23792303] Schweizer F, et al. Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] Augustine R,Majee M,Gershenzon J,Bisht NC Four genes encoding MYB28, a major transcriptional regulator of the aliphatic glucosinolate pathway, are differentially expressed in the allopolyploid Brassica juncea. J. Exp. Bot., 2013. 64(16): p. 4907-21 [PMID:24043856] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li F, et al. Genome-wide association study dissects the genetic architecture of seed weight and seed quality in rapeseed (Brassica napus L.). DNA Res., 2014. 21(4): p. 355-67 [PMID:24510440] Frerigmann H,Berger B,Gigolashvili T bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Burow M, et al. The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis. Mol Plant, 2015. 8(8): p. 1201-12 [PMID:25758208] Martínez-Ballesta M, et al. The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 524 [PMID:26236322] Seo MS, et al. Functional analysis of three BrMYB28 transcription factors controlling the biosynthesis of glucosinolates in Brassica rapa. Plant Mol. Biol., 2016. 90(4-5): p. 503-16 [PMID:26820138] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Mostafa I, et al. New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants. J Proteomics, 2016. 138: p. 1-19 [PMID:26915584] Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding. Plant Physiol., 2016. 172(1): p. 181-97 [PMID:27482077] Aarabi F, et al. Sulfur deficiency-induced repressor proteins optimize glucosinolate biosynthesis in plants. Sci Adv, 2016. 2(10): p. e1601087 [PMID:27730214] Mostafa I, et al. Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29. Front Plant Sci, 2017. 8: p. 534 [PMID:28443122] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]