PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G60890.1

Common Name

ATMYB34, ATR1, MSL3.10, MYB34

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 295aa MW: 32742.6 Da PI: 4.9866

Description

myb domain protein 34

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G60890.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.8	1.1e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl AT5G60890.1 14 KGAWTPEEDQKLIAYLHLHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 61 79********************************************97 PP
2	Myb_DNA-binding	47.4	4.5e-15	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg +++eEd+ +++++++ G++ W++Ia + gRt++++k++w++ AT5G60890.1 67 RGEFSPEEDDTIIKLHALKGNK-WAAIATSLA-GRTDNEIKNYWNTN 111 899*****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.7E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.288	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.96E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.55E-10	16	61	No hit	No description
PROSITE profile	PS51294	24.579	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.1E-25	65	117	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	3.20E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000162	Biological Process	tryptophan biosynthetic process
GO:0002213	Biological Process	defense response to insect
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009753	Biological Process	response to jasmonic acid
GO:0009759	Biological Process	indole glucosinolate biosynthetic process
GO:0010438	Biological Process	cellular response to sulfur starvation
GO:0030154	Biological Process	cell differentiation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0016301	Molecular Function	kinase activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl

Sequence ? help Back to Top
Protein Sequence Length: 295 aa Download sequence Send to blast
MVRTPCCKEE GIKKGAWTPE EDQKLIAYLH LHGEGGWRTL PEKAGLKRCG KSCRLRWANY 60 LRPDIKRGEF SPEEDDTIIK LHALKGNKWA AIATSLAGRT DNEIKNYWNT NLKKRLKQKG 120 IDAITHKPIN STGQTGFEPK VNKPVYSSGS ARLLNRVASK YAVELNRDLL TGIISGNSTV 180 AEDSQNSGDV DSPTSTLLNK MAATSVLINT TTTYSGFSDN CSFTDEFNEF FNNEEISDIY 240 TTVDNFGFME ELKSILSYGD ASAGVIENSP EVNVADAMEF IDSWNEDDNM VGVFV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-25	14	116	7	108	B-MYB
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	111	117	LKKRLKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.8463	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	247600_at	0.0
Expression Atlas	AT5G60890	-
AtGenExpress	AT5G60890	-
ATTED-II	AT5G60890	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in trichomes. {ECO:0000269\|PubMed:23115560}.

Functional Description ? help Back to Top
Source	Description
TAIR	Myb-like transcription factor that modulates expression of ASA1, a key point of control in the tryptophan pathway; mutant has deregulated expression of ASA1 in dominant allele. Loss of function allele suggests ATR1 also functions at a control point for regulating indole glucosinolate homeostasis.
UniProt	Transcription factor involved in tryptophan gene activation and in indole-3-acetic acid (IAA) and indolic glucosinolates (IG) biosynthesis. Acts as a direct transcriptional activator of both Trp synthesis genes and Trp secondary metabolism genes. {ECO:0000269\|PubMed:15579661, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862, ECO:0000269\|PubMed:9576939}.

Function -- GeneRIF ? help Back to Top
The role of ATR1 in the expression of mulitple gene affecting tryptophan metabolism. [PMID: 15579661] Results conclude that ATR1 positively contribute to pathogen virulence inside host cells. [PMID: 18165328]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G60890.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by herbivory. {ECO:0000269\|PubMed:23943862}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G73730 (R), AT2G38470 (R), AT5G07100 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT2G20610(A), AT2G22330(A), AT4G31500(A), AT4G39950(A), AT5G05730(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G32640

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype. Reduced indolic glucosinolate levels in adult leaves and loss of responses to brassinosteroids. {ECO:0000269\|PubMed:15579661, ECO:0000269\|PubMed:23580754}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G60890

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519642	0.0	AY519642.1 Arabidopsis thaliana MYB transcription factor (At5g60890) mRNA, complete cds.
GenBank	BT030326	0.0	BT030326.1 Arabidopsis thaliana unknown protein (At5g60890) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200897.1	0.0	myb domain protein 34
Swissprot	O64399	0.0	MYB34_ARATH; Transcription factor MYB34
TrEMBL	D7MUF2	0.0	D7MUF2_ARALL; Uncharacterized protein
STRING	AT5G60890.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM9331	16	37
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G60890.1
Entrez Gene	836210
iHOP	AT5G60890
wikigenes	AT5G60890

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Bae MS,Cho EJ,Choi EY,Park OK Analysis of the Arabidopsis nuclear proteome and its response to cold stress. Plant J., 2003. 36(5): p. 652-63 [PMID:14617066] Celenza JL, et al. The Arabidopsis ATR1 Myb transcription factor controls indolic glucosinolate homeostasis. Plant Physiol., 2005. 137(1): p. 253-62 [PMID:15579661] Grubb CD,Abel S Glucosinolate metabolism and its control. Trends Plant Sci., 2006. 11(2): p. 89-100 [PMID:16406306] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Skirycz A, et al. DOF transcription factor AtDof1.1 (OBP2) is part of a regulatory network controlling glucosinolate biosynthesis in Arabidopsis. Plant J., 2006. 47(1): p. 10-24 [PMID:16740150] Maruyama-Nakashita A,Nakamura Y,Tohge T,Saito K,Takahashi H Arabidopsis SLIM1 is a central transcriptional regulator of plant sulfur response and metabolism. Plant Cell, 2006. 18(11): p. 3235-51 [PMID:17114350] De Schutter K, et al. Arabidopsis WEE1 kinase controls cell cycle arrest in response to activation of the DNA integrity checkpoint. Plant Cell, 2007. 19(1): p. 211-25 [PMID:17209125] Hirai MY, et al. Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6478-83 [PMID:17420480] Gigolashvili T, et al. The transcription factor HIG1/MYB51 regulates indolic glucosinolate biosynthesis in Arabidopsis thaliana. Plant J., 2007. 50(5): p. 886-901 [PMID:17461791] Dombrecht B, et al. MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis. Plant Cell, 2007. 19(7): p. 2225-45 [PMID:17616737] Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] Sohn KH,Lei R,Nemri A,Jones JD The downy mildew effector proteins ATR1 and ATR13 promote disease susceptibility in Arabidopsis thaliana. Plant Cell, 2007. 19(12): p. 4077-90 [PMID:18165328] Kim JH,Lee BW,Schroeder FC,Jander G Identification of indole glucosinolate breakdown products with antifeedant effects on Myzus persicae (green peach aphid). Plant J., 2008. 54(6): p. 1015-26 [PMID:18346197] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Malitsky S, et al. The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Frerigmann H,B Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] Guo R, et al. BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis. J. Exp. Bot., 2013. 64(8): p. 2401-12 [PMID:23580754] W LEAFY COTYLEDON2 (LEC2) promotes embryogenic induction in somatic tissues of Arabidopsis, via YUCCA-mediated auxin biosynthesis. Planta, 2013. 238(3): p. 425-40 [PMID:23722561] Schweizer F, et al. Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Berger B,Gigolashvili T bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Stahl E, et al. Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance. Mol Plant, 2016. 9(5): p. 662-681 [PMID:26802249] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907] Walker JC Receptor-like protein kinase genes of Arabidopsis thaliana. Plant J., 1993. 3(3): p. 451-6 [PMID:8220453] Bender J,Fink GR A Myb homologue, ATR1, activates tryptophan gene expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 1998. 95(10): p. 5655-60 [PMID:9576939] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]